(data stored in ACNUC9435 zone)

EMBL: AM039951.PE48

AM039951.PE48        Location/Qualifiers
FT   CDS_pept        53668..54459
FT                   /transl_table=11
FT                   /locus_tag="XCVd0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19860"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C056"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19860.1"
FT                   /translation="MPVTSMSDQLRALSVVASERSVGEIVQNLHKMWESVGRLVPERAT
FT                   VGDRVLFRLAKALFQDKIVVAEGLPEDDLVCEQYDQLQRRYLLSDVEGRRSLVSAIRHQ
FT                   HLMQPVHESEEVMPQTALVRVSGAAYVPITLRVMLPPVSLEAHRQELRLNFVQGTERTF
FT                   GFLPMVDVLEYRKRTHSLVALAPLHRWSRNPGQAVQVTYGDWFCADGYGRALYAAAVSG
FT                   LVVRRGESANGMGGVSPMFALTRAGRRAQLATEPAWSCKCL"
     atgcctgtaa cttcgatgag cgatcagcta cgcgccttga gcgtcgttgc tagtgagcgc        60
     tctgtcggcg aaattgttca gaatctacac aagatgtggg agagcgtcgg tcgtctcgtg       120
     cctgaaaggg ccacggtcgg cgaccgggtt ctttttcgac tggccaaggc tctatttcag       180
     gacaagattg ttgttgctga agggctgccg gaagacgacc ttgtctgtga gcagtatgac       240
     cagctgcagc gtcgatatct attgtctgac gtcgagggcc gtcgatcgct agtgtcagca       300
     attcggcacc agcacctgat gcagcctgtg cacgagtctg aggaagtgat gccccaaaca       360
     gcgctagtgc gtgtctccgg tgccgcatac gtacctatca ccttgcgtgt gatgcttccg       420
     ccggtctcgc tggaggcgca tcgccaggag ctgaggctaa actttgtgca gggcactgaa       480
     cgcacattcg gctttttgcc aatggttgac gtgcttgagt accgtaagcg tacacattca       540
     ttggtggcgc tggcgccatt gcatcgctgg agcaggaacc ctggccaggc ggtgcaagta       600
     acgtacgggg attggttttg cgcagatgga tacggcagag cactttatgc agcagcagta       660
     tccggactcg ttgtccgccg cggcgagtcg gccaatggaa tgggaggagt gtcgcccatg       720
     ttcgcgctga cgcgcgcagg gcgcagggcg cagctggcta ctgaaccagc ctggtcttgc       780
     aaatgccttt ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page