(data stored in ACNUC9435 zone)

EMBL: AM039951.PE50

AM039951.PE50        Location/Qualifiers
FT   CDS_pept        56639..57292
FT                   /transl_table=11
FT                   /locus_tag="XCVd0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19862"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C054"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19862.1"
FT                   /translation="MPLNPKHEIYIVGVNVDRYVVYRGSKSKDANSEPAVVKICQGVYM
FT                   QNGLDAESVFNRYGLRIAHYLTPSATISFSTAWHKAPKIGRVFVTGQYQYVRPLFGASD
FT                   RYNIVQSVGKVEPDNPKLHTMETFRDPLGEFTMLCDTPELTLLNMMTATKRHSEKHLNS
FT                   EEMDELLGHLMKEHGGKAGVASALEEVAVMAERTNELRRLIGLLYSPGKSFVSS"
     atgcccctca acccgaagca tgagatctat atcgtcggcg ttaatgtcga ccgatacgtc        60
     gtgtatcggg ggagcaagtc caaggatgcc aactctgagc cagcagtcgt caagatctgc       120
     cagggcgtct acatgcagaa tggcctggac gcagaatcag tgttcaatcg gtatggtttg       180
     cgtattgcac attacctgac accttcagcg acgatcagct tctccaccgc gtggcacaag       240
     gcccccaaaa tcgggcgtgt ctttgtcact ggccaatatc aatatgtgcg tcccctgttc       300
     ggtgccagcg atcggtacaa cattgtgcag tcggtgggga aggtcgagcc tgataacccc       360
     aagttgcata cgatggaaac ttttcgcgat ccgctgggcg agttcacgat gttgtgcgac       420
     acgcctgaac tgactctgtt gaacatgatg accgccacca agcggcattc ggagaagcac       480
     ctcaacagcg aggaaatgga tgagcttctc ggccatttga tgaaggagca cggcggcaag       540
     gcaggcgtgg catcggccct agaagaagtg gcggtgatgg ccgagcggac gaatgagctt       600
     cgtcgcttga tcgggctgct ctacagtccg ggcaaaagtt tcgtttccag ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page