(data stored in ACNUC9435 zone)

EMBL: AM039951.PE51

AM039951.PE51        Location/Qualifiers
FT   CDS_pept        57295..58281
FT                   /transl_table=11
FT                   /locus_tag="XCVd0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19863"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C053"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19863.1"
FT                   /translation="MANWVDLAEHDLVLLWRPKPGCPHARQMILQTVTSGGSIPPDVVE
FT                   LGFLPEGKQYVRDSTVLLPDEFLQIFPRARMIDVPRDFFEHKHGSNIVHLAGRPAPDLA
FT                   ERVSSPHTAVDVGLMRWALTPRPRFILEARTLIEDGASVVSFGGMERLTRKRATSASLK
FT                   SLMHSLAVRAARDAGAQLPFQVMVDYPDYVYFGGARRTHAAYRANSLVARLSVAERLTR
FT                   GASATVVSTHTGVPDLVLRIQQANGQAELVVAQTSVGAVGLAGVAAGFEITRGRLHLAW
FT                   TSQAQQRGFDPLLASLFLSSLLSGGYEADNVRWDRPVLGPERSTAAA"
     atggcgaatt gggtcgacct ggctgagcat gaccttgtgc tgctttggcg gccgaagccg        60
     ggttgcccgc atgcacgcca gatgatcttg caaacggtga cctccggcgg atccataccg       120
     ccggacgttg tcgaactggg cttcttgcca gaaggaaagc aatatgtgcg tgattcaacg       180
     gtgctgcttc ctgatgaatt tctgcagatt ttcccgcgcg cacggatgat tgatgttccg       240
     cgcgatttct tcgagcacaa gcacggaagc aacatagttc acctagccgg aaggcccgca       300
     ccggacctgg ccgagcgagt ttccagcccg cataccgccg tagacgtcgg gctgatgcga       360
     tgggcattga cgcctcggcc gcgattcatt ctagaggcgc gaacgctgat cgaagatggc       420
     gcttccgtgg tttcattcgg cggtatggag aggttgacgc gaaagagagc cacatccgct       480
     tccctcaagt ccctcatgca ctcgcttgca gttcgagccg cgcgcgatgc tggcgcgcaa       540
     ctgcccttcc aagtgatggt tgattaccca gattacgtgt acttcggcgg cgcccgccga       600
     actcacgcag cctaccgggc caacagtctc gtcgcgcgtc tgtcagttgc agagcgattg       660
     actaggggcg cgtccgccac ggtggtcagc acacacacag gggttcccga cttagtgttg       720
     cgcatacagc aggcaaatgg tcaggccgag ctggtcgtgg cgcaaacatc cgtcggcgca       780
     gtagggctcg ccggcgtagc cgccggtttc gaaattacga ggggtcgcct tcacctcgcg       840
     tggaccagcc aggcgcagca gcgtggattt gaccccctgt tagcgtcgct ttttttgtca       900
     agcttgctaa gcggcggcta cgaagccgac aacgttcgct gggatcgccc tgtgcttggt       960
     ccggaaagga gcactgcggc agcctaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page