(data stored in ACNUC9435 zone)

EMBL: AM039951.PE52

AM039951.PE52        Location/Qualifiers
FT   CDS_pept        58342..61245
FT                   /transl_table=11
FT                   /locus_tag="XCVd0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19864"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C052"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19864.1"
FT                   /translation="MPQWIDTQADGVALLARTSVSGAKELVLRRIRPDTVVPDAALTYG
FT                   FEPEGEIFVRKDTRFSLTEIRRIFPSAQVADMALEDIVYRVAAPIARLAVPKSARSAEV
FT                   LTPAADLLDVETPAAPSSWAQVPRGRFLMSARSLVDGGVPVVEFEGISHASPQSPKAVH
FT                   EQAVLAAVNAGESLPFAVLVDYPQIAYFGATKRHASTRVAKLLSSLEITERLLEGERAH
FT                   AVLKNDGFDDLVIVREARPEGQRLSLTHYYDKNGQITLDAELVFHIRGGQLHLSETAVE
FT                   NVLRGGEIRSYDAFLANRLAKNWLDQGFAVAEVHWPNQSVPSVVRAVPVSPEMPPTVDA
FT                   PSVAKVAAGPAAGMSMAFVFDSAGAAKLAVGMSQGAALGNLLAECASPSATNSSRSRIG
FT                   QNLSGMLLLEDANGVRYLELRSEEIAEDLSDRGVEHMTISEAQRAGKLTLAQKEPVKGV
FT                   LLFGRPVYRALKLADGSDAFFAIERGAAGESYAYKLDFADGGRPRWLSLGAAWTHGAPS
FT                   DGELMSSRPRPIDAFDQQAFVHEINQAIAVTSQDVLNERYRMLPLDADRITVRKISEQA
FT                   YEFSSADDWLPFGEVRVEQSGDHWRASHGTTSSSLRCSLEAACSWANRTIATQREHYLA
FT                   HLNQTTDGSLQFAIPEQDFTVLRRVLHKASIGEQTSWQGMGIHGDWTVYPKDLRAEIID
FT                   DRKLRIAVRGRELIYEICSMEADPASTYAHYQTEGLRRIGQWLGQVQDDIRWDETVRAH
FT                   PEGGLLKQRMREYQDLQVKHYGAAKFSARVPSTRAREMVLAITDRDVDRLISVIGDNGP
FT                   NNKSTMRLFQSVSGLRPGHSRTTRAEAVYRFCGYSDEQAAQHARRREDLARVRSMEREA
FT                   KARIEAAANMKVSHNGTEKTGKVMIDDVWAQGYTELSTRRQGASTRYMLRNPTTGQYYD
FT                   LKEPLTGYARHLVTIKDSANFVPGPSDEPEDVHTPGY"
     atgccccagt ggattgatac ccaagcggac ggcgttgcgc tgctcgcgag aactagcgtg        60
     agcggtgcca aagagctcgt cttgcgccgc attcgacccg acaccgttgt gccagatgct       120
     gcccttacct acggttttga acccgagggt gagatattcg tccggaaaga cacccgtttt       180
     agtctgacgg agattcgtcg gatctttccg tctgcacagg ttgcggatat ggcgctggag       240
     gacattgtct accgcgttgc cgcgcccata gccaggctgg ccgtgccgaa gtcggcgcgg       300
     tcagcggaag tgcttacgcc ggccgcggat cttctcgatg tcgaaacacc agcagcccca       360
     tcaagctggg cgcaggtgcc gcgtggacgg ttcttgatga gtgcgcgatc gctggtagac       420
     gggggcgtgc cggtagtgga atttgagggg atctcccacg cttcgcccca gagcccaaag       480
     gcagttcacg agcaggccgt gctagccgct gtgaatgcag gtgagagcct gcccttcgcc       540
     gtcctggttg actaccctca gattgcctat ttcggggcca cgaagcggca tgcctccaca       600
     cgggtggcga agcttctgtc gtcccttgag atcaccgaga gactgttaga aggcgagcgt       660
     gcgcacgcgg tcctcaagaa cgatggtttt gatgaccttg tcatcgtccg cgaggcgcgg       720
     cccgaagggc agcggttgtc gttgacccac tactacgaca agaacggtca gattaccttg       780
     gacgccgagc ttgtgttcca catccgtggt ggccagctcc acctgtctga aacggctgtc       840
     gaaaacgtat tgcgcggcgg tgaaattcga agctacgacg cgttccttgc caaccgcttg       900
     gccaagaact ggctcgacca gggtttcgcg gttgctgagg ttcactggcc gaatcaatct       960
     gtgccttcag tagtccgtgc tgtgccggtc tcaccagaga tgccgcccac tgtcgatgct      1020
     ccctccgtgg caaaagttgc cgctggcccg gccgccggga tgtcaatggc cttcgtcttc      1080
     gactctgcag gagccgccaa gctggcggtc ggcatgagcc aaggcgccgc tctgggaaac      1140
     ctgctcgccg aatgcgcttc gccgtcagcg accaattcct cgcggagccg gatcggccaa      1200
     aacttgtccg gaatgttgtt gctagaagac gcgaacggcg tgcgatacct cgaacttcgc      1260
     tccgaagaga tagcagagga tttgagcgac cgcggcgtgg agcacatgac catcagcgag      1320
     gctcaacgag ccgggaagct gacgcttgcc caaaaagagc cggtcaaggg cgttctgctc      1380
     ttcgggcgcc ctgtctatcg cgcactaaaa ttggccgatg gctcggatgc ctttttcgcc      1440
     atcgaaagag gcgctgccgg cgaaagctac gcatacaagc ttgacttcgc tgacggtggc      1500
     cgcccccgtt ggctgtcctt aggcgcggcc tggacacacg gagcgccaag cgatggcgag      1560
     ctcatgagca gccgaccacg tccgatcgac gcgttcgatc agcaggcgtt cgtgcatgaa      1620
     atcaatcaag cgatcgcagt gacctcgcaa gacgtgctca acgagcgcta tcgcatgctg      1680
     ccgcttgatg ctgacaggat caccgtgcgc aagatatcgg agcaggctta tgagttcagt      1740
     tcggccgatg actggttgcc attcggggaa gtgcgtgtag agcaaagcgg tgaccattgg      1800
     cgtgcttcgc acggcacgac gagctcatcg ctccggtgtt ccctggaggc tgcatgctca      1860
     tgggccaatc gcacgattgc tacacaacgc gagcactatc tcgcacacct caatcaaacc      1920
     actgacgggt cactgcagtt cgccatccct gagcaggact tcaccgtgct tcgacgggtg      1980
     ctgcacaagg cgtcgatcgg cgagcagaca tcgtggcaag ggatgggtat ccacggcgac      2040
     tggacggtct atcccaagga tctccgagcc gagatcattg atgatagaaa actgcgtatt      2100
     gccgtacgcg gacgcgagtt gatttatgag atctgttcga tggaggcgga cccggcctca      2160
     acctatgcgc actaccagac cgagggtctg cgccggatcg gccagtggct cgggcaagtg      2220
     caggacgaca tccgctggga tgagactgtg agagcgcatc cggagggtgg actattgaag      2280
     caacgcatgc gtgagtatca ggacctgcag gtcaaacact acggtgctgc aaaattcagt      2340
     gcgcgtgttc catcgacacg agcgcgcgag atggtgctcg cgatcaccga tcgagacgtt      2400
     gaccgtttga tcagtgtgat tggcgacaat ggacccaaca acaaaagcac gatgcggctg      2460
     tttcaatcgg tgtccggcct gaggcctgga cacagcagaa ccactcgggc cgaagcggtc      2520
     taccgctttt gcgggtatag cgatgagcaa gccgctcaac acgcacggag gcgtgaagac      2580
     ctggcacgtg ttcgctcgat ggagcgagag gccaaggcgc gcattgaggc ggctgcgaac      2640
     atgaaggtct cgcacaacgg cactgagaag acgggcaaag tcatgatcga tgatgtgtgg      2700
     gcgcagggct acacggagct ctctacccga cgccaaggcg cttcgacccg ctacatgctg      2760
     cgcaatccca ccactggcca atactacgat ctgaaagagc cgctaaccgg ttacgcccgg      2820
     cacttggtca ccatcaaaga cagcgccaac ttcgtgccgg ggccatcaga tgagccggaa      2880
     gatgtccata cgccgggcta ctga                                             2904
//

If you have problems or comments...

PBIL Back to PBIL home page