(data stored in ACNUC9435 zone)

EMBL: AM039951.PE53

AM039951.PE53        Location/Qualifiers
FT   CDS_pept        61211..62170
FT                   /transl_table=11
FT                   /locus_tag="XCVd0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19865"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C051"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19865.1"
FT                   /translation="MSRKMSIRRATEDLPMIGRTTTNSRDFEETIGRYFARAIPEGTFT
FT                   EVDRKLPADCHELCRLFRMRPVTLHYGGSDKTLQFEAMVINDRFDKRIFLTNHAKEPLR
FT                   AVIGHELTHRMQIERPDLYRELATAIAAAGVDQERWQAYVQLMRAKSGREGRQLSIGEL
FT                   RSEAVADMVGDLLLDRRLWDALRAPSLAQRVVGWVQSAWRRLTAQAAVQAPLGGAPLAK
FT                   DRLAAITAATVVLQRWAHDVANDPVRRAGLHAVGASCRRAGLRHEADPAAEVIRFTNVA
FT                   GDLVAPDQLPVEVAEAVAALNQTTGELWRAADSVEMRP"
     atgagccgga agatgtccat acgccgggct actgaggacc tgccgatgat cgggcgcact        60
     accactaact ctcgggattt cgaggagacg attgggcgct acttcgcgcg cgcgatccca       120
     gaaggtacgt ttacagaagt tgataggaag ctgccggccg actgccacga gctgtgccgg       180
     ttgttccgga tgcgtccggt cacgcttcac tatggtggct ctgacaaaac gctgcagttc       240
     gaggcgatgg tcatcaatga tcgctttgat aagcgaatct tcctcaccaa tcacgcgaaa       300
     gagccccttc gcgcggtgat cggacacgag cttacgcatc gaatgcagat tgagcgtccc       360
     gacctatatc gcgagctggc cacggcgatc gctgccgcag gcgtggacca agaacgttgg       420
     caagcttacg tgcaactgat gcgcgccaaa tcgggacgag aaggccgcca gctttcgatc       480
     ggagagctcc gcagcgaagc cgtagccgac atggtaggtg atctgctcct tgataggcgt       540
     ctatgggacg ccctgagagc tccatcgctc gcccaaaggg tcgtgggctg ggtacagagc       600
     gcgtggaggc gtctgacggc tcaggcggcc gtccaggcgc cgctgggcgg agcgccgttg       660
     gcgaaggatc gtctggcggc gattactgcg gcgacggttg tcctgcagcg ctgggcacac       720
     gatgtcgcaa acgatcctgt gcggcgggcc ggtctacatg cggtaggggc cagttgccgc       780
     agagctgggc tacggcatga ggcggatcca gccgctgaag taattcggtt taccaatgtc       840
     gccggtgacc tggtcgcccc cgaccaactg cccgtcgaag tcgcagaggc ggttgcggca       900
     ctcaatcaga cgacgggcga gctatggcga gcggcggact cagttgagat gcgcccttag       960
//

If you have problems or comments...

PBIL Back to PBIL home page