(data stored in ACNUC9435 zone)

EMBL: AM039951.PE55

AM039951.PE55        Location/Qualifiers
FT   CDS_pept        complement(65905..66366)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19867"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C049"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19867.1"
FT                   /translation="MVIRASAFVIKKDIDVPLGSVFAFEESWFFRAQVDDGGDIQEVGI
FT                   NLTDGAKYVVLTNPTSALTLAHGLALELRVIGPIRGPGKPPLASLAWSINGGPAISMVD
FT                   YFLALDGGKETTDVRTKHAFFATHWGAWVIDSNGKPISPDPLFVIGSDS"
     atggtgatca gagcaagcgc attcgtgatc aaaaaagata ttgatgtccc cttgggctca        60
     gtgttcgcct tcgaagaaag ctggtttttc agggcacagg ttgacgatgg tggcgacatc       120
     caagaggtgg ggatcaacct gacagacggt gcgaaatatg tggtgctcac aaatcccaca       180
     agtgccctca cgcttgccca cggtctagca cttgagctcc gtgtgattgg cccaattcgt       240
     ggaccaggca agccaccgct cgcgtctctc gcatggagca ttaatggcgg cccggccatt       300
     tcaatggtgg actacttcct tgctcttgac ggaggtaaag agacaacaga tgtccgcaca       360
     aagcacgctt tttttgctac gcactggggc gcgtgggtga tcgattccaa tggtaaacct       420
     atcagtccag acccgctgtt tgtcatcggt agcgactcat aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page