(data stored in ACNUC9435 zone)

EMBL: AM039951.PE56

AM039951.PE56        Location/Qualifiers
FT   CDS_pept        complement(66395..67261)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19868"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C048"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19868.1"
FT                   /translation="MSSRDDLAQVTAERDVLAGLVEQHEARLRNFSADLHHVLMAQLGD
FT                   HEPGAEYMEAWQRLYALIAPVVTGYASTSAELEQAQADHAARLNALVARHDESAATDAI
FT                   VQTDSPEIYELRVGLVHANAAMFTGHRCVHARFSQILSSYRELILRHMPQFTPDEWAAL
FT                   AEMLNDECNEAHYDYLQHLDEDEQLSDQLPHGPFTTDVNRLATVAADRAAQRNAQQRQR
FT                   NADHYDLFAPTVDLLDLASRLSALTDVQRLAAYEKLMWLLYPERCDLVAYDAAKHAAIA
FT                   ELFNGTS"
     atgagcagcc gcgacgacct tgctcaggtg acagccgagc gcgacgttct ggccggcttg        60
     gtggagcagc acgaagcccg gctgcggaat ttcagcgcgg atctgcacca cgtgctgatg       120
     gcccagctcg gggaccatga gccgggagcc gagtacatgg aagcatggca gcgcctgtac       180
     gcactgatcg cgcccgtggt cactggctat gcgtccacat ccgcagaact agagcaagcc       240
     caggccgatc acgcagcacg cctcaatgcc ctagtggcgc gccacgatga gagcgccgca       300
     accgacgcca tcgtgcaaac cgactcgccg gagatctacg agttgcgtgt cgggctggtg       360
     catgccaacg cggcaatgtt caccggccac cgctgcgtgc acgcgcggtt ctcccagatc       420
     ctaagttcgt atcgcgaatt gatcctgcgg cacatgccgc agttcactcc ggacgagtgg       480
     gctgcgctgg ccgaaatgct caacgacgag tgcaacgagg cgcactacga ctacctgcaa       540
     cacttggatg aggatgagca gctatcggat cagttgccgc acggcccttt cacgacggac       600
     gtgaatcgac tggcaaccgt tgctgccgac cgcgccgccc aacggaatgc gcaacagcga       660
     cagagaaacg ccgatcatta cgacctcttc gcccccaccg tggacttgct cgatcttgca       720
     tcgaggttat cagcgctgac cgatgtccag cgcctcgctg cctacgagaa gctgatgtgg       780
     ctgctttatc cggagcgctg cgacctggtg gcatacgacg cagcgaagca tgctgcgatc       840
     gccgagcttt ttaacggcac gtcttga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page