(data stored in ACNUC9435 zone)

EMBL: AM039951.PE57

AM039951.PE57        Location/Qualifiers
FT   CDS_pept        complement(67737..67928)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0057"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19869"
FT                   /db_xref="GOA:Q3C047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C047"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19869.1"
FT                   /translation="MDRKTSKDFFVVMFVTGAVCGVTAIYLMASGKQAGPMVLALGFAA
FT                   NILLVVSMVELHFVPDVD"
     gtggatagga aaactagcaa agatttcttt gtagtcatgt tcgtcaccgg agcggtctgc        60
     ggcgtgaccg caatttatct catggccagt ggcaagcagg ccggcccgat ggtgcttgcc       120
     ctaggctttg cggctaacat tctgttggtg gtcagcatgg tcgagctgca tttcgtgccg       180
     gatgtggatt ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page