(data stored in ACNUC9435 zone)

EMBL: AM039951.PE58

AM039951.PE58        Location/Qualifiers
FT   CDS_pept        complement(68066..69109)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19870"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C046"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19870.1"
FT                   /translation="MAESSRITSTEVFDAIEKLLAAGQPPTHMSVREMLGGRGSGPVLS
FT                   KFIARWFEEHGAEFFIKVGDARSRKPITDIGSQIRHAAEQAAQVLSEAERQRQEALCAR
FT                   ETAAEQRSVMLDAREEALFAAQAKLAERESEQERLIHELQSDKTNLVSRLDQARLDRLQ
FT                   VESELRELSSAIAGVRDELALALQEIAVSQEREQASQLALAEARRERDAASKRFERFED
FT                   AYAKILNAIHLLRESGQEQGTNLLEALQKLSERLELHQTQLDASAAELAAASRRARTLE
FT                   GKLSQSEMKLAAAHGEARTLSAALVERMHMIDQLRAERDAAIALATSVSSSLATISKQV
FT                   ERDGHHG"
     atggccgagt caagccgcat cacatcgaca gaagtgttcg atgcgatcga gaagctactt        60
     gctgcggggc agccgccgac gcacatgagc gtccgcgaga tgcttggcgg tcgcggtagt       120
     ggtcctgtgc tctcaaagtt catcgctcga tggtttgaag aacacggtgc cgagttcttc       180
     atcaaggttg gcgacgcgcg ctcgcgcaaa ccgatcaccg atatcggatc ccagatacgc       240
     cacgctgcgg agcaagcagc ccaggtcctc tctgaggcag agcggcaacg gcaggaggcg       300
     ctgtgcgccc gagagactgc tgcggagcaa cgctcggtga tgctcgatgc gagagaggag       360
     gcgttgtttg ctgcgcaggc gaagctggcc gagcgagaga gtgagcaaga gcgactgatt       420
     cacgagcttc agtcggacaa aaccaacctc gtgtcgcgtc tcgatcaagc gcgtctggat       480
     cggctgcagg ttgagtctga acttcgagag ctgagttccg ccatcgccgg cgtgcgagat       540
     gagctggctc ttgcgctgca agaaatcgca gtgagccagg agcgtgaaca ggcaagtcaa       600
     cttgcattgg ctgaagcccg ccgtgagcgt gacgcggcga gtaagcgttt cgagcgcttt       660
     gaagatgcat acgcgaagat attgaatgcc atacatctct tgcgcgagtc gggtcaagaa       720
     cagggaacga atctgctcga agcactccaa aagctttctg agcgcctgga gctacatcag       780
     acgcaactcg atgcaagtgc tgctgagctg gccgcagcct cgcgcagagc caggacattg       840
     gagggcaaac tatcgcagtc agaaatgaag ctcgcagcag cgcatggcga ggcacgcact       900
     ctttctgcgg ccttagttga acgcatgcac atgatcgatc aactacgcgc cgagcgcgat       960
     gcggctatcg cacttgccac ctcggtgtct tcaagtctgg cgaccatctc caaacaagtg      1020
     gagcgcgatg gccatcatgg gtga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page