(data stored in ACNUC9435 zone)

EMBL: AM039951.PE60

AM039951.PE60        Location/Qualifiers
FT   CDS_pept        complement(69321..69668)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19872"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C044"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19872.1"
FT                   /translation="MSPYEAALQWIMSNPGSGSANSLAKLMMSLWNSRCAFAVSECVWN
FT                   LDGARSELALRAIERYLKEGETPEFNRVCEQIHEAHPRLWELGDAASRAKAQLREKWEL
FT                   EDRRNEDEEQN"
     atgtcgccat acgaagctgc actgcagtgg atcatgagta acccaggaag cggaagcgcc        60
     aacagtctgg cgaagctgat gatgtcgctc tggaattcgc gctgtgcttt tgctgtcagt       120
     gaatgcgtct ggaatcttga tggcgcccgg agcgagctcg cgttgcgggc aatcgagcgc       180
     tacctcaaag agggtgaaac cccggagttc aacagggttt gtgagcagat ccacgaagca       240
     cacccgcgcc tgtgggagct tggcgacgcc gcgtcgcgcg caaaagccca gttgcgggaa       300
     aaatgggaat tggaagatcg tcgcaatgaa gatgaggagc aaaattga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page