(data stored in ACNUC9435 zone)

EMBL: AM039951.PE61

AM039951.PE61        Location/Qualifiers
FT   CDS_pept        complement(69689..72637)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C043"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19873.1"
FT                   /translation="MNENALVVSAVEHGESSRFERLDAPRPGTYWRLLQDVTGEEDGKQ
FT                   IESNPLDAGIVLLLESIEYADGEPHVYKFAAHPGVPEREAYPSLFHADCFWRYWTYCPE
FT                   AALVRERELLALHQEMAQTQARLLEPPPAAKPIANLGYDPSAPTQSEGQALATPEQLRD
FT                   MTVYAERLKKNAEATQKWIAKHSEALKGQGEALARFHMERATVGLAAAQGQLDAVKGIL
FT                   RTVENLKIYTGDGVEVTQLRKGAPAPAELPLTIYQELLSLDEELLLHLEVNGLDHTHLD
FT                   SVATVLADDALLQRLVPAARGMVLCQFRSSYKEFVKPSRPGDIGAAMANQQLNKISQLH
FT                   MLLVRDGEQVYLVEGPEFLQKIKQLMPNAAEQLGHFSGRNGETIRRDDLAYAMAQRRQL
FT                   GALDAYAKVLTMLWGLRDRDVLFADWAVPAFASWLDWGFQERYLRLVDQSVMLGVERPG
FT                   YDAYRQQQNQYLAAGAWVAVRASALFEQRFIPGAFASQETRQFNNRWAHSRVYVLKQRM
FT                   PIIGCVRRDKRGDYIEVPLVHEGYNRSGREITGKLYLCREAMQEVLVLDRVDASDLTYY
FT                   LTSRAQRRSYNDYIQLFQAARTWVAERDSAEGPLRAELRQAVAAARIPHDADALEGAIT
FT                   AALAVARTARRDKCSPAPDSSSYSAYRKGALDTLHALLTDQAGRTAAVDAWCQRQGRRP
FT                   LRLVSTGKGQFKVYLEPVASEHQVLLGDARHASSAAVTFDPHTGEAVLGGWQRELLRAS
FT                   ASEHVIHDWKYITRFAGDPAATSYLDRHDRTIDDGAAKWLAHKSLLGTLRYDQAESLLA
FT                   LPVKQSDSFRRGLDMANLASHAISSRSNKIVRHRLRFAIGIVHARGRPCMLMAEHDSLA
FT                   YCYENANAAGKQACVDLIRAWYKTPEPAVQRLVQGELDWTPCYVDLSAVWTYRDQARCD
FT                   DLDHSGTVFESNVLDPALSEKENSERDIRCMGLTSVGAELFPWLASRTLQAL"
     gtgaacgaga acgccttggt ggtcagtgcc gtcgagcatg gcgagtcgtc ccgattcgag        60
     cgcctcgacg cgccgcgccc gggcacttac tggcgcctgt tgcaagacgt caccggcgag       120
     gaagacggga agcagatcga gagcaatccc ctggatgccg gcatcgtgct gctgctggaa       180
     tcgatcgagt acgccgatgg cgaaccgcac gtctacaaat tcgccgctca cccgggcgtg       240
     cccgaaagag aggcctaccc cagcctgttc catgcagact gcttctggcg atactggacg       300
     tactgccccg aagcggccct ggtgcgcgag cgcgagctgt tggcgctgca tcaggagatg       360
     gcgcagacgc aggcgcgcct gctggagccg ccgccagcgg ccaagccgat cgccaatctc       420
     ggctacgacc ccagcgcccc gacccaatcc gagggccagg cgctggccac gcccgagcag       480
     ctgcgtgaca tgacggtcta tgccgagcgg ctcaagaaaa acgccgaagc gacccagaag       540
     tggatcgcga aacacagcga ggcgctgaaa ggccagggcg aagcgctcgc ccgcttccac       600
     atggagcggg ccacagtggg actggcggcc gcccaggggc agctggacgc ggtcaagggc       660
     attttgcgca cggtggagaa tctcaagatc tataccggcg atggtgtcga ggtgacccaa       720
     ctgcgaaagg gggcgccggc gccagccgaa cttccattga cgatctacca agagttgctt       780
     tcactcgacg aagaacttct gttgcacctg gaagtcaacg ggctagacca cacgcacttg       840
     gactcggtgg cgacggtgct ggccgacgac gcgctgctgc aacgcctggt gccggcggca       900
     cgtggcatgg tcctctgcca gttccgcagc agctacaagg aattcgtcaa gccttcgcgt       960
     cccggagaca ttggcgcggc catggcaaac cagcaactca acaagatcag ccagctgcac      1020
     atgctgctgg tgcgagatgg cgagcaggtg tatctggtcg aaggccccga attcctgcag      1080
     aagatcaaac agctcatgcc caacgcggcc gagcagctcg ggcacttcag tggtcgtaac      1140
     ggcgagacca tccgccgcga cgacctcgcg tacgcgatgg cacagcgccg ccagctcgga      1200
     gcgctggatg cctatgccaa ggtcctcacg atgctttggg ggttgcgcga tcgcgacgtg      1260
     ctcttcgccg actgggcggt gccggcgttt gcctcgtggc tcgactgggg cttccaggag      1320
     cggtatctgc gcctggtcga ccagagcgtg atgctgggtg tcgagcgacc aggctatgac      1380
     gcgtatcgcc agcaacagaa ccaatatctg gcagcgggtg cttgggtcgc cgttcgggct      1440
     tcagctctgt tcgagcagcg cttcattccc ggcgctttcg catcacaaga aactcgccag      1500
     ttcaacaacc gttgggccca cagcagggta tacgtgctta aacagcgcat gccgatcatc      1560
     ggctgtgtgc gccgcgataa gcgtggcgac tacatcgaag tacctctggt gcacgaggga      1620
     tacaaccggt ccggccggga gatcactggc aagctgtacc tgtgtcgaga ggcaatgcag      1680
     gaggtcctgg tgctcgatcg agttgacgcc agcgacctga cctactacct gacctcgcgt      1740
     gcgcaacgtc ggagctacaa cgactatatc cagctgttcc aagccgcccg cacctgggtc      1800
     gccgagcgcg atagcgctga gggtccacta cgggccgagc ttcgccaggc ggttgctgct      1860
     gcgcgaatcc cgcacgacgc ggatgccctg gaaggggcga tcaccgctgc gttggctgtt      1920
     gcgcgcactg cccgtcgcga caaatgctcg ccggcgccgg atagcagcag ctattcagct      1980
     taccgcaaag gcgccctgga caccttgcat gccttgctga ccgaccaggc cggccgcact      2040
     gcggcagtgg acgcctggtg ccagcggcag gggcgccggc cgctgcgatt ggtgtcaacc      2100
     ggtaaaggcc agttcaaggt ctacctggaa ccagtagcca gcgagcacca ggtgctgctg      2160
     ggcgacgcgc ggcacgcctc ctccgcagca gtcaccttcg atcctcatac tggggaggcc      2220
     gttctcggtg ggtggcagcg cgagctccta cgggcctcgg cgagtgagca tgtcatccat      2280
     gactggaaat acatcaccag gttcgcgggg gacccggcgg ccacgtccta tctggaccgc      2340
     cacgatcgga cgatcgatga cggtgcggcg aaatggttgg cgcacaagtc acttctggga      2400
     acgctgcgct acgaccaggc tgaaagcctg ctggcactgc cggtgaagca gtctgattcg      2460
     tttcgccgcg gactggatat ggcgaatctg gccagccacg caatcagcag cagaagcaac      2520
     aaaatcgtcc ggcaccggct gcgttttgcg atcgggatcg tacatgcgcg tggccgtcct      2580
     tgcatgctga tggccgagca cgacagcttg gcgtattgct atgaaaacgc caatgcggcg      2640
     ggcaagcagg cgtgcgtcga cctcatccgg gcttggtaca agacaccgga gcccgccgtc      2700
     cagcgccttg tacagggaga acttgactgg accccctgct acgtcgacct atccgccgta      2760
     tggacttacc gggatcaggc gcggtgtgat gatcttgatc acagtggcac ggtgtttgag      2820
     agcaatgtgc tcgacccggc gctcagcgag aaggagaata gcgagcgcga catccgctgc      2880
     atggggctca cgtccgtcgg cgccgagctg ttcccttggc tcgcatctcg cacgctgcag      2940
     gctttgtaa                                                              2949
//

If you have problems or comments...

PBIL Back to PBIL home page