(data stored in ACNUC9435 zone)

EMBL: AM039951.PE63

AM039951.PE63        Location/Qualifiers
FT   CDS_pept        complement(72868..73266)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19875"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C041"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19875.1"
FT                   /translation="MSENSQHQVIRNAPAPVIAHGQDNPAPNITPAALAQRLNRYADEL
FT                   SEVGRAYSATLLRAAACAISELLKAKAQAANSTAVPERRDELELQSSEQRSYNSGWNAC
FT                   RAAMLGSHTLPPVQCVDLPEAITAAATK"
     atgtctgaga acagccaaca ccaagttatc cgcaatgcgc cagcgccggt cattgcccac        60
     ggacaggaca accctgcccc gaacatcact ccggcggcgc ttgcccaaag attgaaccgc       120
     tatgcggatg aactctcgga agtaggacgg gcttatagcg cgacattgct acgcgctgca       180
     gcttgcgcga tctccgagct gctgaaagcg aaagcgcagg cagcgaacag cacggccgtg       240
     cccgaaaggc gcgacgagct tgaactgcaa tcatcggagc agcgcagcta caacagcggc       300
     tggaacgcct gtcgcgccgc catgcttggg tcccacacgc tgccgccggt ccaatgcgtg       360
     gatctgcccg aagccatcac tgcggctgcg acgaagtga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page