(data stored in ACNUC9435 zone)

EMBL: AM039951.PE64

AM039951.PE64        Location/Qualifiers
FT   CDS_pept        complement(73687..74136)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19876"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C040"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19876.1"
FT                   /translation="MAAKLEIEKEREAVARAVCLACEEVPDHIGDAQGNAHRWQDYLPC
FT                   ADAAIAAFTSHEKGQQASHAVPPAAAPVQVEVLHVSGVPEACKHCGGTAFEWFAHKRAA
FT                   SDVVDGRLRTHEVQCSFVLGCLDCSETLMVVAADTIAGMLSTRSQ"
     atggctgcaa agcttgaaat cgagaaggag cgcgaggctg tcgcacgtgc tgtttgtctg        60
     gcatgcgagg aggtgccgga ccacattggg gatgcgcaag gcaatgctca ccgctggcaa       120
     gactacttgc cttgcgctga tgcagcgatc gcggctttta catcgcacga gaaaggacag       180
     caggcgagcc acgctgtgcc gcccgcggct gctcctgtac aggtggaagt gctgcacgtg       240
     tccggcgtgc cggaagcgtg caagcactgc ggcggcacag cgtttgaatg gttcgcacac       300
     aagcgcgccg cgtccgatgt cgtggacggc cgtctacgga cgcacgaggt gcagtgcagc       360
     tttgtgcttg ggtgcctgga ttgctcggaa acattgatgg ttgtggcagc cgatacgatt       420
     gccgggatgc tcagcacccg ttcccagtag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page