(data stored in ACNUC9435 zone)

EMBL: AM039951.PE65

AM039951.PE65        Location/Qualifiers
FT   CDS_pept        complement(74216..74692)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19877"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C039"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19877.1"
FT                   /translation="MATDESSIEPDIFLLQAVVNGEAWEHSWYVPRWGDPDPRRLDGAV
FT                   YEIDGRKIPNLGVYRVKGFYAEPKVPAVLPVDEQRDAERFRWLCDFAINHEEIDRGTPY
FT                   VVYGIGMGDCEPAVASEIRDMIDAAMARDKHWIAAQLQRTDGDKDAKATKAAKA"
     atggcaaccg atgaaagcag cattgagcct gacattttct tgctgcaggc cgtggtcaat        60
     ggtgaagcgt gggagcacag ctggtacgtc ccccgatggg gcgatccgga tcccaggcgc       120
     ctggatggtg ccgtatacga aatcgacggc aggaagatcc cgaacctcgg cgtctaccgg       180
     gtcaagggat tctatgccga accgaaagtg cccgcggttt tgccggtaga cgagcagcgc       240
     gacgccgaac ggttccgctg gctctgcgac tttgcaatca accacgaaga gattgatcgc       300
     ggcacgccct atgtcgtcta cggcatcgga atgggtgact gcgaacccgc tgtggcctca       360
     gagatcaggg acatgatcga tgccgcaatg gcacgcgata agcactggat cgccgcccag       420
     ctccagcgga cggatggcga caaggatgcc aaggccacca aggccgccaa ggcgtag          477
//

If you have problems or comments...

PBIL Back to PBIL home page