(data stored in ACNUC9435 zone)

EMBL: AM039951.PE67

AM039951.PE67        Location/Qualifiers
FT   CDS_pept        complement(74906..75220)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19879"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C037"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19879.1"
FT                   /translation="MTAVVAYWVAIAREHHRWAADTRAQLQDCRRHGLADRRKQLRKEL
FT                   QRQRDRRALAMVKARLTRDEVARVDALRLAELAHLTAGLVPGLTMGGRPVLAISSETSP
FT                   "
     atgaccgccg tcgtcgcgta ctgggtggcc attgcccggg agcaccaccg ctgggccgcc        60
     gatacccggg cccagctgca ggactgccgg cgtcacgggc tggcggatcg acgcaagcaa       120
     ttgcgcaagg aactgcagcg ccagcgcgat cgccgcgcac tggcgatggt gaaagcacgt       180
     cttacgcggg atgaagtcgc ccgcgtcgat gccctgcggc tggccgagct cgcgcacctg       240
     accgccggcc tggtgcccgg gctgacgatg ggcggccgcc cggtgctggc catcagcagc       300
     gagacatcgc cgtga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page