(data stored in ACNUC9435 zone)

EMBL: AM039951.PE68

AM039951.PE68        Location/Qualifiers
FT   CDS_pept        complement(75217..75522)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19880"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C036"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19880.1"
FT                   /translation="MLEAYRRWGICRCQLGHLLAASGAIQCRQSAVLFRLPQADDGLYV
FT                   VATTDDNDQDLCQVFVAQKVPRRTGHGPARYEQRPMTQRVRDRLLAGGFADEQLLP"
     ttgttggagg cctatcgacg ttggggcatt tgtcggtgcc agttggggca tctgctggct        60
     gccagtgggg cgattcagtg tcggcaatca gcagtgctgt tccgcttgcc ccaagcggac       120
     gacggccttt atgtggtggc caccacggac gacaacgatc aggacctgtg tcaggtgttt       180
     gtggctcaga aagtgccgag gcggaccggg catggtcctg cgcggtacga gcagcgcccg       240
     atgacccagc gggtccgcga tcgactgctc gccggcgggt tcgctgacga gcagctgctc       300
     ccatga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page