(data stored in ACNUC9435 zone)

EMBL: AM039951.PE69

AM039951.PE69        Location/Qualifiers
FT   CDS_pept        complement(76136..76408)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19881"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C035"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19881.1"
FT                   /translation="MTLPDERTRNLLQAGAFLKELAGSQAVPKSVRQEAYRLLRHYPTL
FT                   SDVEAIAQHEERLRDLTQSSFVRPYLTSQFEEDWFRGYPKGPHRT"
     atgaccctgc ctgacgagcg cactcgcaac ctgcttcaag ccggagcgtt tcttaaggaa        60
     ctcgccggaa gccaagccgt gcccaagtct gtgcgccagg aagcctaccg gctgttgcgc       120
     cactacccaa cactcagtga tgtggaagcc atcgcccagc atgaagagcg gttgcgagac       180
     ctcacccaat cgtcgtttgt gcggccgtat ctgacctcgc agttcgagga ggactggttc       240
     cgcggctacc ccaaaggtcc tcatcggacc tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page