(data stored in ACNUC9435 zone)

EMBL: AM039951.PE70

AM039951.PE70        Location/Qualifiers
FT   CDS_pept        complement(76556..77497)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0070"
FT                   /product="putative cointegrate resolution protein T"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19882"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C034"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19882.1"
FT                   /translation="MTRGITESDVHGAADALVADGERPTVERIRAYLGTGSPNTVVRWL
FT                   ETWWQCLGSRLATDRQVRIATANVPEAVAALAGQWWTLALDHARAQADDAMASDRASLL
FT                   DARETLERDRHAMQAELARLESVTHAAQQAEQLAAARTSELERFVEQLQRQLAELSQQR
FT                   DASALRALGAESANEMLRVQLQELQDAARAERDTLTQHMRANEDRAHAEIDHARQESKQ
FT                   AKQQLAASQREAALDKRRLEEALEHAQGDVSALRQDLTIQQARADALEAQLVKLNDLPA
FT                   ALEAAWQQHVGRSPPKRPKPERSKRDRSKAVT"
     atgaccagag gcatcaccga atccgacgtg cacggcgctg ccgatgcact tgttgcagat        60
     ggcgaacgac ctacggttga gcgtatccgc gcctatctgg gtacagggtc accgaacaca       120
     gttgtgcgct ggctggagac ttggtggcag tgtttgggtt ctcgcttggc aacggaccgt       180
     caggtccgga tcgcaacggc caacgtgcct gaagctgtcg cggccctggc agggcagtgg       240
     tggacgttgg cgctagacca cgcccgagcc caggccgatg acgcaatggc ttctgatcgt       300
     gcatccctct tagacgcccg agaaacgttg gagcgagacc ggcacgctat gcaggccgag       360
     cttgcccgac tagaaagcgt aacccacgct gctcagcaag ccgaacaact cgccgccgca       420
     cggacgtccg agttggagcg ctttgtcgag cagctgcagc gtcagctggc cgaacttagc       480
     cagcagcgtg acgcttcagc tttacgcgcc ctcggcgcag aaagcgccaa tgaaatgtta       540
     cgggtccaac tccaggagtt gcaggatgca gcgcgtgccg agcgcgacac cttgacccag       600
     catatgcgcg ccaacgaaga ccgggcacat gcggagatcg atcatgcgcg tcaggaatcc       660
     aagcaggcca agcagcagct agctgccagc cagcgagagg cagcgctgga taagcgccga       720
     cttgaggaag cgctagaaca cgcgcaaggc gatgtttcag cgctccgcca agacctcacg       780
     attcagcagg cacgcgcaga tgcacttgag gcgcaactcg tcaaattgaa cgatttgccg       840
     gcagcactcg aagcagcgtg gcagcaacat gtgggacgga gtccacctaa gcgcccaaaa       900
     cccgaacggt ctaagcgaga tcgtagtaag gcggttacgt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page