(data stored in ACNUC9435 zone)

EMBL: AM039951.PE71

AM039951.PE71        Location/Qualifiers
FT   CDS_pept        77603..78688
FT                   /transl_table=11
FT                   /locus_tag="XCVd0071"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19883"
FT                   /db_xref="GOA:Q3C033"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C033"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19883.1"
FT                   /translation="MKDNSTSSALAQTVQHLVLPEQLAQQAADAVRELLAEAAAANTTR
FT                   SYASALRYWAGWHAARYGIELALPVPEATVLQFVIDHVQRRSTDGELAWELPPMVDQAL
FT                   VAAGLKAKLGPWTLATVRHRVAVLSTAHRLKQVANPCEQPAIRTVLSRAARAAVKRGER
FT                   PRKKTAITLPELEAMLATCDDSLEGIRDRALLCFGFASGGRRRSEIAAADLRDLRRIGE
FT                   AGYIYRLEHSKTQQAGVTVSSTPDKPVLDRAALALEVWLEASGITEGAIFRRLWKQRVG
FT                   PALSPAAVGEIVQRRARLAALEGDFGGHSLRSGFVTEASRQGVALPAIMQLTEHRAVAS
FT                   VIGYFQTGGAAANPAARLLED"
     atgaaggata attccaccag cagcgccctc gcccagacgg tccagcactt ggtgctgccc        60
     gaacagctgg cgcaacaggc ggcggatgcg gtgcgcgaac tgctcgccga agcggccgcc       120
     gccaacacca cccgcagcta cgccagtgcc ctgcgctact gggccggctg gcatgcggcg       180
     cgctacggca tcgagctcgc cttgccggta cccgaagcca cggtgctgca gtttgtgatc       240
     gaccacgtgc agcgccgctc gactgacggc gagctggcgt gggagctgcc gccgatggtg       300
     gaccaggcct tggtggccgc cggcctgaag gccaagcttg ggccctggac cttggccacc       360
     gtgcggcatc gggtcgccgt gctgtcgacc gcgcaccggc tcaaacaagt ggccaatccc       420
     tgcgagcagc cggcgatccg cacggtgctg agccgggccg cccgggctgc ggtcaagcgc       480
     ggtgagcgac cgcgcaagaa gaccgcgatc accctacccg agctggaggc gatgctggct       540
     acctgcgacg acagcctgga aggaatacgg gatcgcgccc tactctgctt cgggtttgcc       600
     agcggtgggc gccggcgtag tgagatcgcc gccgccgacc tgcgcgacct gcgccggatc       660
     ggcgaggcgg gctacatcta ccgcctggag cacagcaaga cccagcaggc cggcgtcacc       720
     gtgagctcga ccccggacaa gccggtgctc gatcgggccg ctctggcact ggaggtctgg       780
     ctcgaggcgt ccggtatcac cgagggggcg attttccggc ggctgtggaa gcagcgcgtg       840
     ggccctgccc tgtccccggc cgcggtcggc gagatcgtgc agcggcgtgc gcgccttgcc       900
     gcgctggagg gggattttgg tggtcacagt ctcaggtcgg ggttcgtgac ggaggcgagt       960
     cgccaaggcg tggcgctgcc ggcgatcatg caactgaccg aacaccgtgc ggtagcgagc      1020
     gtgatcgggt actttcagac aggcggagcc gcagctaatc ctgctgctcg cttgctggag      1080
     gattga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page