(data stored in ACNUC9435 zone)

EMBL: AM039951.PE72

AM039951.PE72        Location/Qualifiers
FT   CDS_pept        78912..80369
FT                   /transl_table=11
FT                   /locus_tag="XCVd0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19884"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C032"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19884.1"
FT                   /translation="MEAGHKSTGVTDTERMLADFCERSFLKLWTYPNPYKEDGKELCDV
FT                   LAVFGDHIFVFFDREKAYSQTPDADPLIAWDRWKRRAIDRQIITAHGAERYLRSGRPIF
FT                   LDAKQTVRFPLEVNRAATVHKIVVAHGAKDACARSSEQNIYGSLAITYCDLDQGHQPRP
FT                   FHVELDRQDPVHLFDSHNLPIVLGELDTISDFSRYLDEKVRAIRRFDVLAYCGAEDLLG
FT                   HYLLNFDQTTNVHRIGFDEPVNGVMIGEGEWHGLVNSALYQNTKREDEVSYFWDELIQR
FT                   TCQNLLDGTLGGNADLLRGQSAIVEMVKEPRFVRRALSSKIRENVINFPDTGGLTRLVS
FT                   LMPSFDPEVGYVFFQLRAPEAIRAQLDYLDKRRTLLEIACGAARNKFPHLRKVIGIGMD
FT                   APKFAGDTNSEDFILMPCEAWPDDVRDHYQALNEDWRFFDTPQLQQYEQTVTQFVPPNE
FT                   AFVGKKVGRNEPCPCGLGKKYKKCHGA"
     atggaggccg gccacaagtc cacgggggtg actgacaccg agcgcatgct cgcggatttc        60
     tgcgagcgct ccttcctgaa gctatggacc tacccgaacc cttacaagga agacggcaag       120
     gagctgtgcg acgtcctggc ggtgttcggc gaccacatct tcgtcttttt cgatcgagag       180
     aaggcctatt cgcagacgcc ggacgccgat cccctgatcg cctgggaccg ctggaagcga       240
     cgcgcgatcg atcgccagat catcaccgcc cacggcgccg agcgttacct gcgcagtggc       300
     cgcccgatct tcctggacgc caaacagacc gtgcgcttcc ccttggaggt gaaccgggca       360
     gccaccgtcc acaaaatcgt ggtggcgcac ggcgcgaaag acgcgtgcgc gcgcagttcc       420
     gagcagaaca tctacggcag cttggccatt acctactgcg atctggacca gggccaccaa       480
     ccccgcccct tccacgtcga gctggatcgg caggatccgg tgcacctgtt tgacagccac       540
     aacctgccga tcgtcctggg cgagctcgac acgatcagcg acttctcgcg ctacctcgac       600
     gagaaggttc gagccatccg acgcttcgac gtgctggcgt actgcggcgc agaggacctg       660
     ctcgggcact acctgctcaa ctttgaccag acgacgaatg tgcacaggat cggcttcgac       720
     gagccggtca acggggtgat gatcggcgaa ggcgaatggc acggcttggt gaattcggcc       780
     ttgtatcaga acaccaagcg ggaagacgag gtctcctact tctgggatga gttgatccag       840
     cgcacctgcc agaacctgct ggacggcact ctgggtggca acgccgacct gctccgcggc       900
     cagagcgcca tcgtcgagat ggtgaaggaa ccgcggtttg ttcgacgcgc cctgtcgagc       960
     aagattcgcg agaatgtcat caacttcccc gacaccggcg gattgacgcg tctcgtgtcc      1020
     ctgatgccgt cgttcgatcc ggaggtcggc tacgtcttct tccagttgcg cgcacccgag      1080
     gcgatccgcg cgcagctcga ctatctcgac aagcgacgca ccttgctcga gattgcgtgc      1140
     ggcgcggcgc gcaacaagtt tccgcacctg cgcaaggtca tcgggatcgg catggatgcg      1200
     cccaagttcg ccggggacac caactccgag gacttcatcc tcatgccctg cgaggcatgg      1260
     ccggacgacg tccgcgatca ctaccaggcg ctcaatgagg attggcgctt cttcgacaca      1320
     ccgcagcttc aacaatacga acagacagtc acccagtttg ttccgccgaa cgaggctttc      1380
     gtcgggaaga aggtcgggcg aaatgaaccg tgcccctgtg gattaggcaa gaagtacaag      1440
     aagtgccacg gcgcgtga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page