(data stored in ACNUC9435 zone)

EMBL: AM039951.PE73

AM039951.PE73        Location/Qualifiers
FT   CDS_pept        80410..81795
FT                   /transl_table=11
FT                   /locus_tag="XCVd0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19885"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C031"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19885.1"
FT                   /translation="MHTISLPRFNALAAWCRFGPTMWILDEIAWFEAADGKLLGVIVRD
FT                   HTDGDFLGIYLAQDRVGRFRHISQTDAFFDTAEAAAAALVAGAPALLARLEAERGQGDE
FT                   EPAPVDFFRLEVARERLHPSFATLLDKEGFSPARAIVEAMMRWYEDVDGNFIEQFQTGG
FT                   FDARLLELYAYALLVENNFSLSREHAAPDFLAEDILGTIAVEVTTVNPTQDRQGNPQPP
FT                   PKITSEDERLAYLKHYIPIKFAGALKRKLGKAYWEMPHVAGKPLVFIIQDFHAAASMTF
FT                   ARTGLINYLYGYEHNAIQDAEGRLVVVATKVTEHRWGGRAAESGFFDLPGAEHVSAVIF
FT                   NSGATLSKFNRIGYVAGFGSRRVRMIRHGTVWNPDPDAAEPIPFAVRVDDPDYAESWTE
FT                   GLDVFHNPRAAIPLNPEHFPAAVHHYLLPDGNINSVQAGGLVQPLASMTNIYILETADV
FT                   KAL"
     atgcacacaa tttccctgcc ccggttcaat gcgttggcgg cctggtgccg cttcggcccg        60
     accatgtgga ttctggacga gatcgcctgg ttcgaagcgg ccgacgggaa gctgcttggg       120
     gtgatcgtgc gtgaccacac cgacggcgac ttcctcggca tctatttggc tcaggatcgc       180
     gtcgggcgct tccgccatat cagccagacc gacgccttct tcgataccgc cgaggccgcc       240
     gctgctgcgc tcgtggccgg ggccccagcg ttgttggccc gcctcgaggc cgaacgtggc       300
     caaggcgacg aagagcccgc gccggtggat ttcttccggc tagaggtggc gcgtgagcgc       360
     ctgcatccta gcttcgccac actcctggac aaagaaggat ttagtccggc acgagccatc       420
     gtcgaggcga tgatgcgctg gtacgaggac gtcgatggca acttcatcga gcagtttcaa       480
     accggcggct tcgatgcacg cctacttgag ctctatgcgt acgccttgct ggtcgagaac       540
     aacttttcgc tctcgcgcga gcacgccgct cccgatttcc tcgccgaaga catcctcggc       600
     acgatcgcgg tggaggtcac gaccgtcaac ccgacccagg atcgccaagg caatccgcag       660
     ccgccaccca agattacctc cgaggacgag cgccttgcct acctcaagca ctatatcccg       720
     atcaaatttg ctggtgcgct gaaaaggaag ctcggcaagg cgtactggga gatgccgcat       780
     gtcgccggca agcccttggt gttcatcatc caggatttcc acgcggccgc ctcgatgacc       840
     ttcgcgcgca ccggactgat caattacctg tacgggtacg agcacaacgc gatccaggat       900
     gcagagggca gactcgtcgt ggtggcgacc aaggtgacag aacatcgctg gggcggcaga       960
     gcggcggagt cgggattctt cgatctgccc ggggccgagc acgtcagcgc cgtgatcttc      1020
     aacagcggcg cgaccctgtc gaagttcaac cggatcggtt acgtggccgg cttcggctcc      1080
     cggcgggtcc ggatgatccg gcacggcacc gtctggaacc cggatcccga cgcggccgaa      1140
     ccgatcccgt tcgcggtgcg cgtcgatgat ccggactatg ccgaatcgtg gaccgaaggc      1200
     ctggatgtct ttcacaaccc ccgcgcggcg attccgctca accccgagca ctttccagcg      1260
     gctgtgcatc actacctgct gccggacgga aacatcaatt cagtccaggc aggcggcctc      1320
     gtgcaaccgt tggcctccat gaccaatatc tatattctcg agacggccga cgtcaaggcg      1380
     ctgtag                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page