(data stored in ACNUC9435 zone)

EMBL: AM039951.PE75

AM039951.PE75        Location/Qualifiers
FT   CDS_pept        83244..85442
FT                   /transl_table=11
FT                   /locus_tag="XCVd0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19887"
FT                   /db_xref="GOA:Q3C029"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C029"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19887.1"
FT                   /translation="MAPTPRNTLIANGQALIGDLAWPTGGGPKWHPYDIAVQRDVLHPQ
FT                   LTAVARAAREVSRVYSPRGEVTARLTLHPTFLAKTHFPAHILRDAGLTVLGSRATQVTP
FT                   RVSQGDKQGPQDTAEILVAGTPEGFEAMDRQLGDPAIAKGRQEEFTHIESVLTYAGESK
FT                   LRLDPDTPWPDFVHVTLHAGEHDADLLTAFQTFTLQLGGEISARGFRFVPGLAFVAVQL
FT                   PADSVPELARFERIRLVRSMPRLREQLDLTAALTRKFPTLVLPASRLTAPGPRVAVFDG
FT                   GTQNSFGAHVVELAAPGLPPATVADLAHGVNVTSALLFGPVDPSHTALSAPPWMVEHHR
FT                   VLPTNDSPEQALDVLDRIVTALRIARTADRPYRFANISLGPVATFFDDDIHEWTSRLDT
FT                   ELADGRTLCTAAVGNNGALDGELGRIQPPGDAVNLFAIGAADTRHPKWNRAPYSATGPG
FT                   RSPGFVKPDVLAFGGSPAEPMPVYSPLAGGVVAVGGTSFASPLALRTALGVDVLSQSRF
FT                   DPITLQALLINAAECRRGHKRTDVGWGRIPLGPDAIVHTPLDVVRVVYQGITHPGHPQK
FT                   AVIPVPRGLPAGTRVRIGATFCYRAQVDSAHAINYTRAGLWVRCYKAPGQSLPLFGSGM
FT                   YKSEEELRRDAMRWDTVLNNACTVDAAELDAPYFHINYQVRDESEAVRWEDAVPMPYAL
FT                   IVTLQAPGVADLMTRVQAEFPVLQTLPVEVQVPVDGLS"
     atggccccca ccccgcgcaa cacgctgatc gccaatggcc aggccctcat cggcgacctg        60
     gcgtggccaa cgggcggcgg cccaaagtgg cacccgtacg acatcgcagt tcagcgcgat       120
     gtcctacatc ctcagctcac ggccgtggcc cgggcggcgc gcgaggtctc gcgtgtctac       180
     tcgccgcggg gcgaggtcac cgcgcggctg acgctgcatc cgaccttcct ggccaagacc       240
     cacttccccg cccacatcct gcgcgacgcg ggcttgaccg tgctgggctc gcgcgccacg       300
     caggtcacgc ctcgcgtcag ccagggggac aagcagggcc cgcaggacac cgccgagatc       360
     ctggtggcgg gcacgccgga gggattcgag gcgatggatc gccagctcgg cgatccggcc       420
     atcgccaagg gccggcagga agaattcacg cacatcgaat cggtcctgac atacgccggc       480
     gagagcaagt tgcgcctgga cccggacacc ccgtggccgg atttcgtgca cgtcaccttg       540
     catgccggtg agcacgacgc cgacctgctg accgcgttcc agaccttcac cttgcagctg       600
     ggcggtgaga tcagcgcacg cgggtttcgc ttcgtgccgg ggttggcctt cgtcgcggtc       660
     caactgccgg ccgacagcgt tcccgagctc gcgcgcttcg agcggattcg tctggtccgg       720
     tcgatgccgc gcctgcgcga acaactcgat ctcaccgcgg ccctgacgcg caagtttcct       780
     accctggtgc tgccggcttc gcggctgacg gctccgggcc cccgcgtggc cgtgttcgac       840
     ggcggcacgc agaactcctt cggcgcccac gtggtcgaac tggctgcgcc cggcttgccg       900
     ccggcgacgg tcgcagactt ggcgcacggg gtcaacgtca cctccgccct gctgttcggc       960
     ccggtcgatc cgtcgcacac cgcgttgtcc gcaccgccgt ggatggtcga gcaccaccgc      1020
     gtgctgccga ccaacgacag ccccgagcag gccctcgacg tgctcgaccg catcgtcacc      1080
     gccttgcgca ttgcgcgcac ggccgaccgc ccgtatcgct tcgccaacat cagcctgggg      1140
     ccggtggcga ccttcttcga tgacgacatc cacgagtgga cctcgcggtt ggacaccgaa      1200
     ctggcggacg gacgcacgct gtgcacggct gcggtgggca acaacggcgc gctagacggc      1260
     gagctcggtc gtatccagcc gcccggggat gccgtgaatc tgttcgcgat cggtgccgcg      1320
     gatacgcgcc accccaagtg gaaccgcgct ccgtacagcg caaccggccc cggccgcagc      1380
     ccaggattcg tgaagccgga cgtactcgcg ttcggcggtt cccctgccga gccgatgccg      1440
     gtgtacagcc cgctggcggg cggcgtcgtt gccgtgggtg gcaccagctt cgctagcccc      1500
     ttggccttgc gcacggcgct cggcgtggac gtgctgagcc aatcgcgctt tgatccgatc      1560
     acgttgcagg ccctgctgat caacgccgcc gaatgccggc ggggccacaa gcgcaccgac      1620
     gtgggctggg gccgtattcc gctgggcccg gacgccatcg tgcacacccc gctagatgtc      1680
     gtgcgcgtgg tctaccaggg catcacccac cccggccatc cgcagaaggc ggtgatcccg      1740
     gtgccgcgcg ggctcccggc cggcacccgg gtgcgcatcg gtgcgacgtt ctgctatcgc      1800
     gcgcaggtcg attctgccca cgcgatcaac tacacccggg cgggtctgtg ggtgcgctgt      1860
     tacaaggcgc cgggccagag cctgcccttg ttcggcagcg gtatgtacaa gtccgaggaa      1920
     gaactgcgcc gcgacgcgat gcgctgggac acggtgttga acaacgcgtg cacggtcgac      1980
     gcggccgagc tcgacgcgcc ctatttccac atcaactacc aggtgcgcga cgagagcgag      2040
     gcggtgcgtt gggaagatgc ggttccgatg ccctacgccc tgatcgtgac gctacaagcg      2100
     ccaggcgtgg ccgatctgat gacacgggtc caggcggaat ttccggtcct gcagaccctg      2160
     ccggtcgagg tccaggtgcc ggtggacggg ctgagctag                             2199
//

If you have problems or comments...

PBIL Back to PBIL home page