(data stored in ACNUC9435 zone)

EMBL: AM039951.PE76

AM039951.PE76        Location/Qualifiers
FT   CDS_pept        85510..85761
FT                   /transl_table=11
FT                   /locus_tag="XCVd0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19888"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C028"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19888.1"
FT                   /translation="MAKKHESSGPKVTRTASSVLRDSGASKTAKSLAGSTLAQAGTRKV
FT                   SSATTARTAAKALNDGRTSAGTKALAGSVLTQRPGKRK"
     atggccaaga agcacgagtc ctcgggtccg aaggtgacgc gcacggcgtc ctcggtgttg        60
     cgcgacagtg gcgccagcaa gaccgccaag agcctggcgg gcagcaccct cgcccaggcc       120
     gggacccgca aggtctcctc ggcgaccacg gcccgtaccg cggccaaggc gctcaatgac       180
     gggcgcacca gcgccggcac caaggccttg gccggcagcg tgctcacaca gcgacccggc       240
     aagcgcaagt ag                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page