(data stored in ACNUC9435 zone)

EMBL: AM039951.PE78

AM039951.PE78        Location/Qualifiers
FT   CDS_pept        86685..87308
FT                   /transl_table=11
FT                   /locus_tag="XCVd0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C026"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19890.1"
FT                   /translation="MTSPNRRLSLEDVLDALFLRDDAPTPEMIVQACQAHAEFREEILE
FT                   FAALQAAQAALPDVAESDLEVSDASVMRLQSHVLNLLYGAPPTRADADAVRQAVRSLAG
FT                   QRLQAAAQAIDLGSTVLLHKVLTRAIIDTPRVVFVRLAQFLKVGVDGLVDALGPQLALH
FT                   RSYKAADKPTMVKQESWEQAVAALAVDEAEKARLRAMQDRSDPA"
     atgacttcgc ccaaccgtag gctttcgctt gaggacgtgt tggatgcgct gttcctgcga        60
     gacgacgcgc cgacgcccga gatgatcgtc caggcctgcc aggcgcatgc ggagttccgc       120
     gaggagatct tggagttcgc ggccctgcag gcggcgcaag ccgccctgcc cgacgtagcc       180
     gagtccgacc tggaggtttc cgacgcgtcc gtgatgcgcc tgcaaagtca cgtactcaat       240
     ttgctgtacg gcgcgccgcc cacccgcgcc gatgccgacg ccgtccgcca ggcggtgcgt       300
     tcgttggccg ggcagcgcct ccaggcggcg gcccaggcga ttgacttggg ctcgaccgtg       360
     ctcctccaca aagttctgac gcgggcgatc atcgatacgc cgcgcgtggt gttcgtacgc       420
     ttggcgcagt tcttgaaagt cggagtggac gggctcgtgg acgccttggg gccccaactg       480
     gccttgcacc gcagctacaa ggccgcggac aagccgacca tggtcaaaca agaatcgtgg       540
     gagcaggccg tggccgccct cgccgtcgac gaggccgaga aggcacggct gcgcgcaatg       600
     caggatcgga gcgatcctgc gtga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page