(data stored in ACNUC9435 zone)

EMBL: AM039951.PE80

AM039951.PE80        Location/Qualifiers
FT   CDS_pept        90720..91226
FT                   /transl_table=11
FT                   /locus_tag="XCVd0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19892"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C024"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19892.1"
FT                   /translation="MSTIRVYVQSEHFSNIKLVEVDDHATIADLKRAALTLLPAGTDPT
FT                   GLSLSIEDDDVDDDEAASKRRLKDLNPDRGVRVHLHRCKQVAVTVRFGGRSEEHPFRPA
FT                   TTIGRIRQWAGRRFGLKAGDIAEHVLQIAGSNEQPDMDTHVGTLVQHPRCAIVFDLVPA
FT                   HRING"
     atgtccacca ttcgcgtcta tgtgcagtcg gagcacttct ccaacatcaa gctggtggag        60
     gtcgacgacc acgccaccat cgccgatctc aagcgcgccg cgctcaccct gctcccggcc       120
     ggcaccgatc cgaccggcct gtcgctgtcc atcgaggatg acgacgtcga tgacgacgag       180
     gccgcatcga agcgccgcct caaggacctg aacccggacc gcggggtgcg cgtgcacctg       240
     caccggtgca agcaggtcgc ggtcacggtt cgcttcggcg gacgctcgga agagcatccg       300
     ttccgcccgg cgacgacgat cggtcgcatc cgccagtggg cgggtcgccg gttcggcctg       360
     aaggcgggcg acatcgccga acacgtcctg cagatcgcgg gttccaacga gcagccggac       420
     atggacacgc acgtgggcac gctggtgcag cacccgcgct gtgcgatcgt gttcgacctc       480
     gtgcccgcgc accggatcaa cggctga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page