(data stored in ACNUC9435 zone)

EMBL: AM039951.PE81

AM039951.PE81        Location/Qualifiers
FT   CDS_pept        91226..91696
FT                   /transl_table=11
FT                   /locus_tag="XCVd0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19893"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C023"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19893.1"
FT                   /translation="MAAQVPPDEQSLRADLASACFLSGQDRGRWRLHRLDWPFVFIGVI
FT                   AGNGQEFVLRLDCRGFPTAPPTGTFWDLGAGVRLPDARWPRGGERISLAFRPDWKGGMA
FT                   LYVPCDRESLVGHDAWPAQYPQLIWNPARGISHYLEVVHELLQGIDHERAAA"
     atggccgcgc aggtgccgcc ggatgagcag tccttgcgcg ccgacctcgc gtcggcgtgc        60
     ttcctgtccg gccaggatcg cgggcgctgg cggcttcacc ggctcgactg gccgttcgtc       120
     ttcatcggcg tgatcgccgg taacgggcag gagtttgtgc tgcggctcga ctgccgaggg       180
     ttcccgaccg ctccgcccac gggcacgttc tgggacctgg gcgccggcgt gcgtctgccg       240
     gacgcgcgat ggcctcgcgg cggcgagcgg atcagtctgg ccttccggcc cgactggaag       300
     ggcgggatgg cgctgtacgt gccctgcgac cgggagagcc tggtcggcca cgacgcctgg       360
     ccggcgcagt acccgcagct catctggaac cccgcgaggg ggatctcgca ctacctcgag       420
     gtggtgcacg aactgctaca aggaatcgac catgaacgcg ccgcagcttg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page