(data stored in ACNUC9435 zone)

EMBL: AM039951.PE82

AM039951.PE82        Location/Qualifiers
FT   CDS_pept        91677..92168
FT                   /transl_table=11
FT                   /locus_tag="XCVd0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19894"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C022"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19894.1"
FT                   /translation="MNAPQLEIAPTLWSAILAHLRQQGAGVRESGGFLLGRVRNGVRVV
FT                   TGFLPYEQLQADALQADFVHLSSASFSRLWDYCATHGLEVVADVHTHRYGAGQSRSDSE
FT                   NPMLAIAGHVALIVPEFAQGPTGFEHLGLYVYQGAHRWARYRGAAVAQVLKFTPPEGER
FT                   "
     atgaacgcgc cgcagcttga gatcgcgccg acgctgtggt cggcgatcct cgctcacctt        60
     cgccaacagg gcgcgggggt gcgcgagagc ggcggcttcc tgctgggccg ggtccgtaac       120
     ggggtccgcg tggtcaccgg cttcctgccg tacgagcagt tgcaggcgga cgcgttgcag       180
     gcggacttcg tgcatctgtc cagcgccagc ttcagtcggc tctgggacta ctgcgccacg       240
     catggcctcg aagtcgttgc cgacgtgcac acgcaccgtt acggcgcagg acagagccgc       300
     agcgacagcg agaacccgat gctggcgatc gcggggcacg tggccttgat cgttcccgag       360
     ttcgcgcagg ggcccaccgg cttcgagcac cttgggctgt acgtctacca gggcgctcat       420
     cgttgggcgc gctaccgcgg agcggccgtg gcgcaggttt tgaagttcac accgccggag       480
     ggcgaacgat ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page