(data stored in ACNUC9435 zone)

EMBL: AM039951.PE83

AM039951.PE83        Location/Qualifiers
FT   CDS_pept        92165..93523
FT                   /transl_table=11
FT                   /locus_tag="XCVd0083"
FT                   /product="UBA/ThiF-type NAD/FAD binding fold containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19895"
FT                   /db_xref="GOA:Q3C021"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C021"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19895.1"
FT                   /translation="MTLFDADAMHRLAKLALDAGEVTTPDAALELFRQYRLRIHLGTGW
FT                   ANTLAGQACVLTAVSTASRALLGGVEVTGDLTPVMQVPLFAGQRAADVVAALGGAATAM
FT                   PTPRLPSLMIGDGPPPEGVALTLRPSWDGWCAQVAPADSDDHLTVGDDNPLAGVCAGAL
FT                   AVSEVFSHVRADSPEAGYRRIGLSLWNPLAIEDWNAPENRGPALAYLPTDLWLIGIGHL
FT                   GQAYAWGLAMLPYPAQRRPRLVLQDVDRVTESNLSTCLLVGADDVTARKTRVMARRLEA
FT                   IGFDIDLVDRRFGAQHLLQPGEPTVALFGVDNVAARRDLDTAAFVLIVEAGLGSGYRDF
FT                   RNLRLHTFPGPRPATELWPAQAASQPLTELNTAYQQLAHDSGDLCGVTMLASKAVATPF
FT                   VGAFAASLALAELVRPLHGGCVHASLDCPLRSLTHRLGEPTPANARCAFIALP"
     atgactcttt tcgatgccga tgcgatgcac cgcttggcga agctggcgct ggacgctggc        60
     gaagtcacca cgccggacgc ggcgcttgaa ctgttccgac agtacaggct gcgcatccac       120
     ctgggcacgg gctgggcgaa cacgcttgcg ggccaggcct gtgtcctcac ggcggtcagt       180
     accgcctcgc gagccctgct gggcggcgtg gaagtgaccg gtgatctcac cccggtgatg       240
     caggtaccgc tgttcgcggg ccagcgtgcc gcggacgtcg tggcggcgct cggcggcgcc       300
     gcgaccgcga tgccgacgcc aaggctgccg tcgctgatga tcggggacgg tccgccgccg       360
     gagggcgtcg cgctcacctt gcgcccgtcc tgggatggct ggtgtgcgca ggtcgccccc       420
     gccgacagtg atgaccacct gacagtcggc gacgacaacc cgttggcggg cgtctgcgcc       480
     ggtgcgctgg ccgtgagcga ggtgttctcc cacgtgcgcg ccgactcgcc ggaggcgggc       540
     tatcgccgga ttggcctatc gctgtggaac ccgctggcga tcgaggactg gaatgcgccc       600
     gagaaccggg ggccggcact ggcgtacttg ccgaccgatc tgtggttgat cggcatcggg       660
     cacctcgggc aggcctacgc ctggggtctg gcgatgctcc cctaccctgc gcaacgccga       720
     ccacggctgg tcctccagga tgtcgaccgc gtaaccgaat cgaacttgag cacttgccta       780
     ctggtgggcg ccgacgacgt cacggcgcgc aagacgcgcg tcatggcacg acgcctggag       840
     gcgatcggct tcgacatcga cctggtggat cgccgcttcg gcgcgcagca cctgctgcag       900
     ccaggggagc caaccgtggc gctgttcggc gtggacaacg tggcggcgcg gcgcgatctc       960
     gacaccgcgg cgtttgtcct gatagtcgag gccgggctgg gcagcggcta tcgcgacttt      1020
     cgtaacctgc gcctgcatac ctttcccggg ccgcgcccgg ccacggagct gtggccggcc      1080
     caggccgcga gtcagccgtt gacggagctc aacaccgcat accagcagct cgcacacgac      1140
     agcggcgacc tgtgcggcgt gacgatgttg gcctccaagg cagtggctac gccgttcgtg      1200
     ggcgcattcg ccgcgagcct ggccctcgcc gaactcgttc ggccgctgca tggcggctgc      1260
     gtccacgcca gccttgactg cccgctgcga tcgctcacgc atcgtcttgg tgagcccacc      1320
     cctgcgaatg cgcgctgcgc gttcattgca ctgccctag                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page