(data stored in ACNUC9435 zone)

EMBL: AM039951.PE84

AM039951.PE84        Location/Qualifiers
FT   CDS_pept        93531..94070
FT                   /transl_table=11
FT                   /locus_tag="XCVd0084"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19896"
FT                   /db_xref="GOA:Q3C020"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C020"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19896.1"
FT                   /translation="MKSSRHSNRHVSVADNTSAPTTWVERKLMFLQAYKGECGVAYLLG
FT                   VLGVFAPTTVALFIIDRPAYLAMGWSQSLLVVGAVGGMVTALLMCGLVIQAVAERRTPA
FT                   SAYERQRLMRDTLVCGSVMAMFAQFAGLTVALTSRMDIPSYAYTVLLIAVGYATAQGAS
FT                   ALLTRARQKVLARIGR"
     atgaaaagct ctcgccactc caatcgacat gtttcggtcg cagacaacac ctcggcgccg        60
     acgacctggg tcgaacgcaa gctcatgttc ctgcaggcgt acaaaggcga atgcggcgtc       120
     gcctatctgc tcggcgtctt gggcgttttc gcaccgacga ccgtcgcctt gttcataatc       180
     gatcgaccgg cgtacctggc gatgggctgg agccaatccc tgctcgtggt cggcgccgtg       240
     ggcggcatgg tgaccgcgtt gctcatgtgc ggcctcgtga ttcaggccgt ggccgagcgc       300
     cgcacgcccg cgtctgccta cgagcgccaa cgcttgatgc gcgacacgtt agtgtgcggg       360
     tcggttatgg cgatgtttgc gcagttcgcc ggcctcaccg ttgcgctcac ctcgcgcatg       420
     gacatcccaa gttatgccta caccgtccta ctgatcgcgg tgggatacgc cacagcccaa       480
     ggagcctcgg ccttgctgac gcgcgctcgg cagaaggtgc tagcacgcat tggccgctga       540
//

If you have problems or comments...

PBIL Back to PBIL home page