(data stored in ACNUC9435 zone)

EMBL: AM039951.PE85

AM039951.PE85        Location/Qualifiers
FT   CDS_pept        complement(94208..94690)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19897"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C019"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19897.1"
FT                   /translation="MPWQNDLRRTSRDAVVAERVIVAVEQLLERDRHLFVHRVGERAIS
FT                   HRLAIYVEAQFPGWDVDCEYDRDNAARKMIPDGTGNDDDEGSAVLPDIIVHRRGPGENH
FT                   VVFELKKSSNRLPDDRDLEKLRAYGRHLGYAHGVFIRFVVGEPNPDISRAEFIYGD"
     atgccgtggc aaaacgatct gcgacgcacc tcgcgagatg ctgttgtcgc ggagcgcgta        60
     attgttgctg tggaacaact gctggagcgt gaccgccacc tcttcgttca tcgtgtcggt       120
     gagcgggcca tctcgcatag gctagcgatc tacgtggagg cacagttccc tggctgggac       180
     gtcgactgcg aatacgaccg ggataacgcg gcgcggaaaa tgattccgga tgggaccggc       240
     aacgatgacg acgaaggcag cgccgtcctg ccggacatca tcgttcaccg ccgaggcccc       300
     ggcgaaaacc acgtcgtgtt cgaactcaag aagtccagca atcgtctgcc cgatgaccgg       360
     gatctggaga aactgcgtgc gtacgggcgt cacctgggat acgcacacgg cgttttcatt       420
     cgtttcgtcg tgggtgagcc caaccccgac atcagccggg cggagttcat ctacggcgac       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page