(data stored in ACNUC9435 zone)

EMBL: AM039951.PE86

AM039951.PE86        Location/Qualifiers
FT   CDS_pept        94907..96058
FT                   /transl_table=11
FT                   /locus_tag="XCVd0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19898"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C018"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19898.1"
FT                   /translation="MGSGGLARQGPGSGDIAQLNSAASLFLQVPMRITNDNYSPIELLA
FT                   EIATRRGTTSADTHRFFQGGKTSHDWLVEEWSSRVDCILESFKRYGIDVNATQFVRDQG
FT                   IDVLLRVPNHQGKEWRLGFQIKSEQEAERDRTKKPGQENMIGTLKRQAHDAFERVDEWW
FT                   ILCCFDLDKHYKLVQGISSELTGGKQNRLIRVIDPRACAAMLRMSEAEVDAFCTLLLCR
FT                   DDAVLRAAREEVAACHPNVGAFVLEHIVPALVDGERVSREEVASFLEEAFRKSERERLE
FT                   DGGGEDDDCEAVIELDEDADEHGSVQDGIDDDEEFEDLDIHEMLQELESNGFLAAGTYD
FT                   DDYRISPTAFPGVCALFFEARVRHGLNDDAAASYMRWLTLRQH"
     atgggttccg gtggtttggc acgccaaggg ccgggatcag gcgacattgc gcagttaaac        60
     tccgctgctt cactattcct ccaagtcccg atgcgaatca ccaacgacaa ttactcgccc       120
     atcgaactcc tggctgagat cgccactcga cgcgggacta catcagccga cacccatcgt       180
     ttttttcagg gtggcaagac gagccatgat tggcttgtcg aggaatggtc cagtcgagtc       240
     gactgcattc ttgaatcgtt caagcgctac ggtatcgatg ttaatgccac tcagttcgtc       300
     cgagaccagg gaatcgacgt tctgctccgc gtcccgaacc atcagggcaa ggagtggcgt       360
     ttggggttcc aaataaagtc cgagcaagag gccgaacggg atcgcaccaa gaagcccggc       420
     caggaaaaca tgattgggac tttaaagcgc caggctcacg acgcatttga gcgcgtcgac       480
     gagtggtgga ttctctgctg ttttgacctg gataagcact acaaactcgt ccagggtatc       540
     agctcagaac tgactggagg caagcagaac cggttgattc gtgtcattga ccctagagcc       600
     tgcgcggcca tgttgcgtat gagtgaagcc gaagttgatg cgttctgcac gttgcttttg       660
     tgcagagatg atgcagtcct gcgggctgcc cgtgaggagg tggctgcctg ccacccgaac       720
     gttggggctt ttgtgcttga acacatcgtt cctgcgctag tggacggaga gcgcgtttct       780
     cgcgaagagg tagcgtcgtt ccttgaagag gcctttcgga agtctgagcg tgaaagactt       840
     gaagacggcg gaggtgagga tgacgactgc gaagctgtca tcgagctcga tgaagatgct       900
     gacgagcacg ggagtgtgca agatggcatc gacgatgacg aggaattcga agatctggat       960
     atccacgaaa tgctgcagga actggagagc aatggttttc tggcagcagg cacctatgac      1020
     gatgactatc ggatatcgcc aacggcgttt cctggtgtct gtgcgctgtt cttcgaggct      1080
     cgggtcaggc acggactcaa cgatgacgca gcggccagct acatgcgttg gcttaccctc      1140
     cggcagcact ag                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page