(data stored in ACNUC9435 zone)

EMBL: AM039951.PE87

AM039951.PE87        Location/Qualifiers
FT   CDS_pept        96358..98460
FT                   /transl_table=11
FT                   /locus_tag="XCVd0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19899"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C017"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19899.1"
FT                   /translation="MNLEAFRQIVDSAGPGIAVCADDLQRLYEYVGLEGRGSYTRKAVS
FT                   DALYASIRSCFTSGHSAVWRACKSLRRDLIREHVLLGVSLDPYFDVLDHLQDAVRTDGA
FT                   SRASIEGDWNQAIRAALDHVQIHSRDQMNRTMLHARDFQVAEAARTLRDAGFSIRLEAG
FT                   RLGLEETSETALVAAIEDLSAAMGGINVARRIFNAISPHYDVDQQRYHVVRRTSMIGGG
FT                   LAQMPWGYMLQLAAKHARGRKPYKNNDDQWRMLCGLSQAYAAIFDVQPYTPTIYGTMDA
FT                   TGLVPYLQEMAIYDTLFRIPQMRPTDVVKIARGMFSWLDTSVPTKGGWSINHVLEIIDY
FT                   LLDPGRNARGPIFVTESDIRRSCSHIPREIVTQILSEVLSHPLSGANQNFSRPTDAPAP
FT                   EGPNVKSAGHDFFLRPLLRMSDQQFSLLDRSVCAPAFLEAMLTPLRAEIKGLDDKIGVA
FT                   IERFLEAEFASHGVPTGGGDYDVGGNHGECDLIIEMPDTVIFSEVKKKTLTRRAKAGSD
FT                   AHLLVDLANSLLVAQVQAGWHEVRLRQHGHLDLERNGTVMRLELNDRQVERVAVSLFDF
FT                   GSFQDRILLKQFLEATMYATFTPTALNLQSKFAEINAALIEIRDQVVALYPGQNEINQP
FT                   FFNCWFVSVPQLLVLLDGVTNAAGFKRALWSCRHFVTGSSDLYFDLSYRRQLERETAAN
FT                   PVTPAV"
     atgaatctcg aggcattccg ccaaatcgtt gacagcgctg gacccggcat tgcagtgtgc        60
     gcggacgatc tccagcggct ctatgaatat gtggggctcg agggccgcgg ctcctatacg       120
     cgcaaggcgg tgtctgatgc cctgtatgcg agcatccgga gctgctttac ttcgggtcac       180
     tctgcggttt ggcgcgcttg caagtcgctg cgtagggacc tcattcgcga gcatgtgttg       240
     ctcggtgtgt cgctcgatcc gtatttcgat gtgctcgatc atctgcagga tgccgtccgt       300
     accgatggcg catcccgtgc gtcaatcgag ggcgactgga atcaggcaat tcgggctgcg       360
     ctcgaccatg tccagattca tagcagggac cagatgaacc ggacaatgct ccatgcccgt       420
     gatttccaag tggcggaggc agctcgtacc ttgcgcgatg caggattttc tattcggctg       480
     gaggccggcc ggttaggtct tgaggaaaca tccgagaccg cgctagtcgc ggctattgaa       540
     gatttgagcg ccgccatggg tgggatcaat gttgctcgtc ggatcttcaa cgcgatttca       600
     ccgcactacg atgttgatca gcagcgctat cacgtcgtgc ggcgtacctc catgattgga       660
     ggcggactcg cccagatgcc atggggctat atgcttcagt tagcggccaa gcacgcccgg       720
     ggccgtaagc cttacaaaaa caacgacgac caatggcgca tgctttgcgg gctgtcgcaa       780
     gcgtatgccg ccatttttga tgttcaaccg tatacgccga ccatctacgg cacgatggat       840
     gccaccggcc tcgtgccgta ccttcaggaa atggcaatct acgacacgct gtttcgcatc       900
     ccgcaaatgc gtccgacgga tgtggtgaag attgcacgcg gaatgttcag ttggctggac       960
     acaagcgtgc caacgaaggg gggatggtcg atcaaccacg tgctggaaat cattgactac      1020
     ttgctcgacc ctggccgcaa tgcgcgcggg cccatcttcg tgaccgaatc cgatatccgg      1080
     cgctcctgct cgcacattcc gcgtgaaata gtgacacaga ttctaagtga ggtactcagc      1140
     catccgttgt ccggggcgaa ccagaatttt tcgcgcccga ccgacgctcc cgcccccgaa      1200
     ggtcccaatg tcaagagcgc gggacatgac ttctttctcc gcccgctcct tcggatgtcg      1260
     gatcagcagt tttccttact tgatcgttca gtctgtgctc cagctttttt agaggcaatg      1320
     ctgacgccct tacgagcaga gataaagggg ctggacgaca agattggcgt ggcaatcgaa      1380
     cgctttcttg aggcggagtt cgcctcgcat ggcgtgccca ccggcggcgg ggactatgac      1440
     gtcggcggaa atcacggcga atgcgatttg atcatcgaga tgcccgatac agtgatcttt      1500
     tcagaggtaa agaagaagac gctcacaagg cgggcgaaag caggatccga tgcgcacttg      1560
     ctggtggatc ttgcgaatag tcttttggtc gcccaagtgc aggccggatg gcacgaggtg      1620
     cgactgcgcc agcatggcca cttggacctt gaacgtaatg gaaccgtcat gcgcttagaa      1680
     ttaaacgacc ggcaggtcga acgggtggcg gtgtccctct ttgacttcgg cagtttccag      1740
     gatcgaatcc tcctaaaaca gttcttggag gcaaccatgt acgcgacctt tactccgacc      1800
     gccttaaact tgcagagcaa gttcgcagag attaatgcgg cactaatcga gattcgcgat      1860
     caggtggtgg cgctctatcc cggtcagaat gagataaatc agccattctt caactgctgg      1920
     ttcgtcagcg taccgcagtt actggtcctt ttggacgggg tcaccaatgc ggctggtttt      1980
     aagagggcac tttggagttg ccgacatttc gtgaccggga gttccgacct gtatttcgat      2040
     ctttcataca ggagacaatt agaaagggag acggctgcga atccagtcac gccggctgtc      2100
     tag                                                                    2103
//

If you have problems or comments...

PBIL Back to PBIL home page