(data stored in ACNUC9435 zone)

EMBL: AM039951.PE88

AM039951.PE88        Location/Qualifiers
FT   CDS_pept        98677..98829
FT                   /transl_table=11
FT                   /locus_tag="XCVd0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C016"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19900.1"
FT                   /translation="MVWDAHAKPYCGFLLQVTARRDALAERLEQKLRASGMLGIAPASS
FT                   GAKGQ"
     atggtatggg acgcgcatgc caagccctat tgtgggtttc tgttgcaagt caccgcacgc        60
     cgggatgcac tggctgagcg actggagcag aaactgcggg cgagcggcat gttaggaatc       120
     gctccagcat cttccggcgc caaaggccag tga                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page