(data stored in ACNUC9435 zone)

EMBL: AM039951.PE89

AM039951.PE89        Location/Qualifiers
FT   CDS_pept        complement(98928..99539)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19901"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C015"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19901.1"
FT                   /translation="MARGAISADECFVGYVPPTGIVSSPSRSICVDEVARWVRACRDRS
FT                   IVGCTYQSMEEEGPKAVRLSPHALGFDGLRWHIRAYCHERMIFRDFAIGRLGIQIVEEG
FT                   DSHVDPREDVGWTTLVEVVLVPHPKLGRLQREAVARDYGMSSDRHVLTCQKAMLFYTLR
FT                   HLNLESLSVSERAAEQHVIVENVEQVKRWMEEDRAGIQGL"
     ttggcccggg gcgccatctc cgcagacgag tgctttgtcg ggtatgtgcc ccctaccggg        60
     attgtgtcca gcccgtcccg gtcgatttgc gtggacgagg ttgcccgctg ggtgcgagct       120
     tgccgcgatc gcagcatcgt gggctgcacg tatcagtcga tggaggagga gggcccgaag       180
     gccgttcgct tgtcgcctca cgcactgggg tttgatgggc tgagatggca tattcgggcg       240
     tattgccatg agcgcatgat ctttcgggat tttgcgatcg gccgtctggg gatacagatc       300
     gttgaggaag gcgacagcca cgtggacccg cgcgaggacg ttggatggac cacactggtg       360
     gaggttgtac tggtacccca cccgaaactg ggccgcttgc aacgggaggc ggtagcgcgc       420
     gactacggca tgtcttcaga tcgacacgtg ctgacctgcc aaaaggcgat gctgttctac       480
     acactgcgtc atctgaacct ggaaagcctt tcagtcagtg agcgtgccgc agaacagcac       540
     gtcattgttg agaacgtcga gcaagtgaaa cgctggatgg aggaggatcg cgcaggaata       600
     caagggctgt ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page