(data stored in ACNUC9435 zone)

EMBL: AM039951.PE92

AM039951.PE92        Location/Qualifiers
FT   CDS_pept        complement(100891..101652)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0092"
FT                   /product="cointegrate resolution protein T (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19904"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C012"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19904.1"
FT                   /translation="MGASNQTACAVPEAGVIILQLSGGWARFGCFLYQSLPTLVLQAER
FT                   EAGDAARGEVARRTTELAQLEERIAGLTARLAEHQSHARSLEQKHDHAREALEHYRTSV
FT                   KDQREQEQRRHEHQVQELQVALRQANEALTAKNHDLMQLNRENGQWLERHTRLERELTQ
FT                   TRQRADAQQRERDALRLAAAEHQGLQARWTKDVQALEGVRAELAAASALRWRTRKRHRS
FT                   RCNARRQMISRLAKARESSASVPSSSQPGFR"
     atgggcgcat cgaaccagac ggcatgcgca gtgccggaag ccggagtgat aattcttcaa        60
     ttatcaggcg gttgggcaag atttggctgt tttttgtatc aatccctgcc gaccctcgta       120
     ctgcaggcag aacgcgaggc gggcgacgcc gccaggggcg aggtggcccg ccgcaccacc       180
     gaactggctc agttggagga gcggatcgcg ggcctcacgg cgcgactggc ggagcaccaa       240
     agccacgccc gctccctgga gcagaagcac gaccacgcca gggaagccct ggagcactac       300
     cgcacctcgg tcaaggacca gcgtgagcag gaacaacgcc ggcacgagca ccaggtacag       360
     gaactgcagg ttgccctacg gcaggccaac gaggcgctga ccgccaagaa ccacgacctg       420
     atgcagctca accgggaaaa cggccagtgg ctggaacgcc atacccggct ggagcgggaa       480
     ctgacgcaga cacgccagcg ggccgacgcc cagcagcgcg agcgcgacgc gctgcgcctg       540
     gcggccgccg agcaccaagg cctgcaggcg cgctggacca aagatgtcca agcgctggaa       600
     ggcgtgcgcg ccgaattggc tgcggccagc gcactccgtt ggcgaactcg aaaacgccat       660
     cgcagccggt gcaatgcccg caggcaaatg atcagccgct tggcgaaggc tcgggaatcc       720
     tccgcgtcag tgccttcgtc gtcccagcca ggatttcggt aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page