(data stored in ACNUC9435 zone)

EMBL: AM039951.PE93

AM039951.PE93        Location/Qualifiers
FT   CDS_pept        101887..102924
FT                   /transl_table=11
FT                   /locus_tag="XCVd0093"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19905"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C011"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19905.1"
FT                   /translation="MRKFKSKYMLGACIVGSIVSAGAAAQVAAINNTGRAEAMSAWETT
FT                   LKHEAPAMEGCFSSTFPDMGWQAVRCGAPPKLVMKPRHVASGNVRTTTDNRVLITGNGD
FT                   DYAARTGRLTHSAVGSFPSVSGVTTGVVQYSLQINTDNDSNPAACAQFGFSSCKTWQQY
FT                   VYSSDADEDSSNGFDPVIFIESWVYADSTSEYDAAGCPSGWDAYEGNACVINSESVRVP
FT                   LVPVSGIAGVKLTGSATSGGVDTVSFSVNGRAYSVSQRASTVDINKIWRLTEFNIFGNG
FT                   ARTQTVSFNRGSHVTVNVAVNDGTTNAPTCLGNAGQTFEQNNLTRGSCSVFGGASPGIS
FT                   FPQSN"
     atgagaaaat ttaaatcgaa gtacatgctt ggcgcctgca tcgttggaag catcgttagc        60
     gcgggtgcag cggcgcaggt cgctgcaata aacaatactg gccgtgccga ggctatgtct       120
     gcatgggaaa ctacgctcaa gcacgaggct ccggctatgg agggctgctt tagctcgaca       180
     tttccggaca tggggtggca ggcggtacgc tgtggcgcac cgccgaagtt ggtcatgaag       240
     ccacgacacg ttgccagcgg caacgttcgt accaccaccg acaaccgtgt gctcatcacc       300
     ggcaatggcg atgactacgc tgcacgcacg ggcaggctca cccactcagc cgtcggttcg       360
     ttcccgagcg taagcggcgt gaccactggg gtagtccaat actcgctgca aatcaatacc       420
     gacaacgaca gcaaccccgc cgcttgcgcg cagttcggtt tttcttcgtg caagacctgg       480
     caacagtacg tctactccag cgacgccgac gaagactcaa gtaatggctt tgacccggtc       540
     atcttcattg aaagctgggt atatgcggac agtacctcgg aatacgatgc ggcgggttgc       600
     ccgtccggct gggatgctta cgaaggcaac gcttgcgtga ttaacagcga atcggtgcga       660
     gtgcctctgg tgccagtttc gggcatcgct ggtgtcaagc tgaccggttc tgcgacctcg       720
     gggggcgtgg ataccgtgtc gttttcggtg aacggaaggg cctacagcgt gagtcagcgc       780
     gcctctacgg tggatatcaa taagatctgg cgcctgaccg aattcaacat cttcggcaac       840
     ggcgccagaa ctcagacggt gtcgttcaat cgcggctcgc acgtcacggt aaacgtagcc       900
     gtaaacgatg gtacgacaaa tgccccgact tgcctgggca atgccggcca gacgttcgag       960
     cagaacaacc tgacgcgcgg tagttgctcc gtctttggtg gcgcttcgcc cggcattagc      1020
     tttcctcaaa gcaactga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page