(data stored in ACNUC9435 zone)

EMBL: AM039951.PE94

AM039951.PE94        Location/Qualifiers
FT   CDS_pept        complement(102912..103979)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0094"
FT                   /product="cointegrate resolution protein T (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19906"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BTA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19906.1"
FT                   /translation="MARSGLYKSDVQRARDSLRATGKNPSVDAVRVALGNTGSKTTIHR
FT                   YLRELEEEEGQGVGAKMAVSDALQDLVARLAERLHGEADTVVAQAQARFQAQLQERTQT
FT                   LEQARQEADSLTTQLQRCETVLQAECEASATARSEVASRTTELAQLEERIAGLTARLAE
FT                   HQSHARSLEQKHDHAREALEHYRTSVKDQREQEQRRHEHQVQELQVALRQANEALTAKN
FT                   HDLMQLNRENGQWLERHTRLERELTQTRQRADAQQRERDALRLAAAEHQGLQARWTKDV
FT                   QALEGVRAELAAVRTDLIEERQRREHAEADTLRATVRLSTLEQLLAQLRPPRPVGEQVT
FT                   SGKDETSPDANSQLL"
     atggcacggt ctgggctgta caaaagcgat gtgcagcgtg cccgcgatag cctgcgcgca        60
     acgggcaaga atccgtctgt cgatgcggtc cgggtggcgc tcggcaatac cggttccaag       120
     accaccattc accgttatct gagggagttg gaagaggagg aagggcaagg cgttggcgcg       180
     aagatggccg tgagcgacgc actccaagac ctcgtcgccc gcctcgccga gcggttgcac       240
     ggcgaggccg acacggtcgt ggcgcaggcc caggcgcgct tccaggcgca gctccaggag       300
     cgcacccaaa cgctggagca ggcccggcaa gaggctgact cactcacgac gcagctgcag       360
     cgctgcgaga ccgtactgca ggccgaatgc gaggcgagcg ccaccgccag aagcgaggtg       420
     gccagccgca ctaccgaact ggctcagttg gaggagcgga tcgcgggcct cacggcgcga       480
     ctggcggagc accaaagcca cgcccgctcc ctggagcaga agcacgacca cgccagggaa       540
     gccctggagc actaccgcac ctcggtcaag gaccagcgtg agcaggaaca acgccggcac       600
     gagcaccagg tacaggaact gcaggttgcc ctacggcagg ccaacgaggc gctgaccgcc       660
     aagaaccacg acctgatgca gctcaaccgg gaaaacggcc agtggctgga acgccatacc       720
     cggctagagc gggaactgac gcagacacgc cagcgggccg acgcccagca gcgcgagcgc       780
     gacgcgctgc gcctggcggc cgccgagcac caaggcctgc aggcgcgctg gaccaaagat       840
     gtccaagcgc tggaaggcgt gcgcgccgaa ttggctgcgg tgcggaccga tctgatcgaa       900
     gagcgccagc gccgggaaca tgccgaggcg gacaccttgc gggccacggt acgtctgagc       960
     acgctggaac agctcctggc gcagctgcgg ccaccgcgcc ccgttggcga acaagtaacg      1020
     tctgggaagg acgaaacctc cccagacgca aatagtcagt tgctttga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page