(data stored in ACNUC9435 zone)

EMBL: AM039951.PE95

AM039951.PE95        Location/Qualifiers
FT   CDS_pept        104170..104373
FT                   /transl_table=11
FT                   /locus_tag="XCVd0095"
FT                   /product="cointegrate resolution protein S fragment"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19907"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C009"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19907.1"
FT                   /translation="MISVGQYLEAATRPNTQRAYAAATRHFEVEWGGHLPATAEQVARY
FT                   LAAYAGQLALNTLRHRLAALAQ"
     atgatcagcg ttgggcagta cctggaagcc gccacccgac ccaacaccca acgcgcttac        60
     gccgcggcga cccgccattt cgaggtcgag tggggtggtc atctgccggc gaccgcagag       120
     caggtggcgc gctacttggc cgcctacgcc gggcaactcg cgctaaacac actcaggcac       180
     cggctcgcag cactggccca gtga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page