(data stored in ACNUC9435 zone)

EMBL: AM039951.PE96

AM039951.PE96        Location/Qualifiers
FT   CDS_pept        104425..105138
FT                   /transl_table=11
FT                   /locus_tag="XCVd0096"
FT                   /product="putative cointegrate resolution protein S"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19908"
FT                   /db_xref="GOA:Q3C008"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C008"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19908.1"
FT                   /translation="MLKGIQTVHPSQEKRATPLQLTQLGQVVDWLDGAATAAGTRDDAA
FT                   GRLRHLRDRAFVLLGFWRGFRGDELVRLQVQDLELVAGEGMTCFLPHSKSDRQHAGTTY
FT                   KVPALSRWCPVAATMTWVAAAALHEGPLFRAVNQWGGIAAAPLHPNSLVPLLRRIFREA
FT                   GLSSPDDYSGHSLRRGFAGWANANGWDVKALMEYVGWRDVHSAMRYLDGADPFARRRIE
FT                   ASLPEAPALPRPATT"
     gtgctcaagg gcatccaaac ggtgcatccg agtcaggaaa agcgagccac gccactacag        60
     ctcacgcagt tgggtcaggt cgtggattgg ctcgatggcg ccgcaactgc ggccggaacg       120
     cgtgacgatg cggccggtcg gctccggcac ctgcgcgatc gcgcctttgt actgctgggc       180
     ttttggcgcg gtttccgcgg cgacgaactg gttcgcctcc aggttcagga tttggagttg       240
     gtggccggcg aaggcatgac ctgcttcctg ccgcacagca agagcgatcg ccagcacgcc       300
     ggcaccacct acaaggtccc ggcactgtcg cgctggtgcc cggtggctgc caccatgacc       360
     tgggtcgcgg cagccgccct ccacgagggg ccactgtttc gcgcagtcaa ccagtggggc       420
     gggattgccg ccgcgccact ccaccccaac agcctggtgc cgctgctacg gcggatcttc       480
     cgcgaggcgg ggctgagctc tccagacgac tacagcggcc actcgctgcg gcgcggcttt       540
     gccggctggg ccaacgccaa cggctgggac gtcaaggcgc tgatggagta cgtcggctgg       600
     cgcgacgtgc actcggcgat gcgttacctc gacggggccg atccgttcgc ccgccggcgc       660
     atcgaagcca gtctgccgga agcgcccgcg ctgccaaggc ctgcaacgac ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page