(data stored in ACNUC9435 zone)

EMBL: AM039951.PE98

AM039951.PE98        Location/Qualifiers
FT   CDS_pept        complement(108441..109667)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0098"
FT                   /product="putative replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19910"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C006"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19910.1"
FT                   /translation="MKKISELTAQPTSAEMLQWRDGYRHHLESKGIPPESAADLAAKVS
FT                   YRADLYPTDLAATRPLFQVEPPTAPGEQATDAKVPPLKDSRPDKAKPTKAAKLKRVEPA
FT                   ALERKPKTTTATAREERLIKTAAEIAGERPDDDDRAYMHSIMCQVGLPRSKVDGTSFER
FT                   HSGGAALLVEAGKLWDGKQFVQQPIPYGAMPRLMLAWMNTYAVRFNSPEIPVGDSASEF
FT                   LRMLGQKNITGGERGTFTNFRKQVQALSACRMTLGFNANGRAHTYEGKPIKHFEAWINL
FT                   EEKQRALWPGSVTFSQDYYLTLKDHAVPLDLRAFMELKGSALDLDVYAWLAQRLHRIEG
FT                   RPVVLYWTNLRDQFGQEYQGKEADKDFKKKFLPSLRRVLAVYPDAKVKQVTGGIMLMAS
FT                   PPPIPYKGS"
     atgaagaaaa tcagcgaact aaccgcccag ccaacatcgg ccgaaatgct ccaatggcgt        60
     gacggatacc ggcaccacct tgaatcaaag ggtatcccac cagaatctgc cgcagatttg       120
     gcagccaagg ttagctatcg ggccgacctc taccctaccg acctagccgc gacgcgcccc       180
     ctattccagg tcgaaccgcc gaccgcaccg ggagaacaag ccacggatgc caaagtcccc       240
     ccgctaaaag actcccggcc agacaaggca aagcccacta aggcggcaaa acttaagcgc       300
     gtagaaccgg ccgcgcttga gcggaagccc aaaactacga cagctaccgc gcgcgaagaa       360
     cgtctaatca aaacggccgc agagattgcc ggcgaacgtc cggatgacga cgaccgcgcc       420
     tatatgcact cgatcatgtg ccaagtcggc ttgccacgat ccaaggtgga cggcacatcg       480
     tttgagcggc attcgggcgg cgcagcgcta cttgttgaag ctggcaaatt atgggacggc       540
     aagcagttcg tgcaacaacc aatcccctac ggggccatgc cgcgcctgat gttggcgtgg       600
     atgaacacct atgccgttcg gttcaactcg ccagagattc cggtaggcga cagcgcgagt       660
     gaatttctgc ggatgctcgg tcaaaagaac atcacaggcg gcgaacgggg caccttcacc       720
     aatttccgca agcaggtaca agccttgtcc gcctgccgta tgaccttggg cttcaacgcg       780
     aacggccgcg cccacactta cgagggcaag cccatcaaac acttcgaagc atggatcaat       840
     ctggaagaga agcagcgcgc tctttggccc ggttccgtga cgttttcgca agactactac       900
     ctgacgctca aagaccacgc cgtaccactc gacctgcgcg ccttcatgga gctgaaaggc       960
     tcggcgctcg atcttgacgt gtacgcgtgg cttgcccagc gcctgcatcg catcgagggc      1020
     cggccggtcg tgctgtattg gacaaatttg cgtgatcagt tcgggcagga gtatcagggc      1080
     aaggaagccg acaaggactt caagaagaaa ttcctgccct cactccgacg cgtgcttgcc      1140
     gtctaccccg atgcgaaggt caagcaggtg acaggcggaa tcatgctgat ggcttcgccc      1200
     ccgccgatac cctacaaagg ctcatag                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page