(data stored in ACNUC9435 zone)

EMBL: AM039951.PILN

AM039951.PILN        Location/Qualifiers
FT   CDS_pept        12131..13867
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="XCVd0012"
FT                   /product="putative PilN-like Bacterial type II and III
FT                   secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19824"
FT                   /db_xref="GOA:Q3C092"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR013359"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C092"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19824.1"
FT                   /translation="MKYIFTLAAAVTMLTGCSHSIRNADRSYNDVDGEAKKLLIDMRTP
FT                   AVPGQRETVTISNSQWVEPVPMAVTTPKLPAALRCDPGFKTLEPMGLLEFAQAVSESCK
FT                   MAVRVTADALSAFGSGDSNSATSGPSAGASVPVGGMPLPNLPMLPPVTGTAANASGGIG
FT                   GRAGGALLSNIEWKGPLAGLLDLVASRYGLSWRYSERNNSVSIFHVDSRTFQLDAFPNQ
FT                   VDIQSTTHNGMSSQLGSGGGGGGGGGGSGGGASSGGSSGGGVSGTVGSSQTTVTSMKSS
FT                   LYTDVESAIKVLLTPGIGRVALSPSTGAVTVTDTPDVLDRIGSMLERENTTLTKQVTLH
FT                   AKVLSLTLNDANEVGVNWDVVYRSLSRQFEFTTPFQPASSAGTLGASVINTGKFAGTNV
FT                   IVSALSTLGTVNTITSPSLKTLNLRPAPIQIARQIGYIQSAQISQTEGAGTLGGLTPGF
FT                   VTVGFNMTVVPRLLAQNEEMILQYSINISALNELRSEEAGGTKIEMPDIDTRNFNSEVR
FT                   LHAGETLILHGFEQENHSSNRRGMGSPFAWMLGGSARGQRQRTAIVILITPEVGSSISA
FT                   MR"
     atgaagtaca tcttcaccct ggctgcggcc gtcactatgc tgactggatg ctcgcacagc        60
     atccgcaatg ccgaccgctc ttacaatgat gtcgatggtg aagcgaagaa gctgctgatc       120
     gatatgcgga ctccggccgt tcccggccaa cgggaaaccg tcaccatttc caactcgcaa       180
     tgggtggaac cggtgccgat ggcggtcact actcccaagc ttccggcagc tctgagatgc       240
     gacccaggat tcaaaacctt ggagccaatg ggtcttcttg aattcgcgca ggctgtttcg       300
     gaatcctgca agatggcagt gcgcgttaca gcagatgcgc tatccgcttt tggcagtggc       360
     gatagcaata gtgcaacgtc cggaccgtct gcaggtgcat ctgtgccggt tggcggtatg       420
     cctctaccaa atctcccgat gttgccacct gtcacaggca ccgctgccaa cgcaagtggt       480
     ggaatcggtg gtcgcgccgg cggagctttg ctaagcaaca tcgaatggaa aggcccactg       540
     gccggcttgc ttgatctcgt cgcctcgcga tatgggcttt cttggcgcta cagcgagcgg       600
     aataacagcg tttcgatctt ccatgtggat agccgcactt tccagctgga cgcgttcccc       660
     aaccaagttg atattcagtc aacgacccac aacgggatga gctcacaatt gggctccggt       720
     ggcggtggcg gtggcggtgg cggtggcagt ggcggtggcg ccagcagcgg cggatccagt       780
     gggggtggtg tcagtggcac agtcggaagc tctcaaacga ccgttacgtc aatgaagtcc       840
     tcgctgtaca ccgatgtcga aagtgcaatc aaggttctgc taactcctgg catcggccgt       900
     gtcgcgcttt caccgagcac aggtgcggtg acggtgacgg atacgccgga tgtgctcgat       960
     cgtattggga gcatgctgga gcgggagaac acgacactta ccaagcaggt gacgttgcac      1020
     gcgaaggtgc tttcgctgac ccttaacgat gcaaacgaag taggcgtgaa ttgggacgtg      1080
     gtgtacaggt cgctgtcgcg tcagttcgaa ttcaccaccc cctttcaacc cgcgtccagc      1140
     gcaggaacac tgggcgcgtc agtcatcaac acgggcaagt tcgccgggac caatgtcatc      1200
     gtttctgctc tgtcgacact tggtaccgtc aacaccatca cttcgccttc gttgaagaca      1260
     ttgaacctgc gtccggcgcc catccagatc gctcgccaga ttggctatat ccagagcgca      1320
     cagatctcac aaaccgaggg tgctgggacg ctcggcgggc tgacccccgg atttgtcact      1380
     gttggcttca acatgacggt ggttccccga ctccttgcgc agaatgagga gatgattttg      1440
     cagtactcga tcaacatctc ggctctgaat gagttgcgga gcgaagaggc tggcgggacc      1500
     aagatcgaaa tgcctgacat cgacacgcgc aacttcaaca gcgaggtccg actgcacgct      1560
     ggggaaacgc tgatcctcca cggattcgaa caggagaatc actcgtcaaa tcgccgcggc      1620
     atgggcagcc cattcgcatg gatgctgggt ggaagcgcta gaggacagcg tcagcgcacg      1680
     gccatcgtga tcctgattac cccagaagtc ggatcttcaa tttcggctat gcgctga         1737
//

If you have problems or comments...

PBIL Back to PBIL home page