(data stored in ACNUC9435 zone)

EMBL: AM039951.PILO

AM039951.PILO        Location/Qualifiers
FT   CDS_pept        13907..15253
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="XCVd0013"
FT                   /product="putative PilO-like pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19825"
FT                   /db_xref="GOA:Q3C091"
FT                   /db_xref="InterPro:IPR009663"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C091"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19825.1"
FT                   /translation="MARRKSIDTSIADRQKIGTFVLNGRTFVSGLHWETLDNVSSFMKE
FT                   ARSKGRQWGMDVVATRKGVDLRSKGKSAKYQAGYAPKNRGAAKGMYSLASVLASEFGSN
FT                   WIGAFRIEEERYALAAVVDGSIVPSADRIGTLSEIREELGANFSHLAGSGVLFEHVIAP
FT                   PEFEFGDKQVDLASLLVASKLKPEHRLKPLTLGLSKGELFRLTLFAAIIVAGGALYILY
FT                   QAREEEMLRRADQAQKAARARAEALLNIKPPPPAPPPPWLASAKITDTVAACSAAIDKL
FT                   PLVLGGWIFEKASCNAGGALSAAYKRGHLATANSVLSAAEAAGLPLDFYDAGESGVVNV
FT                   LIHMPSASSEELLAEKQVMARLVSHFQAAGVKFPLQKQAIPETPPGEEPTTSKPNWSTY
FT                   TFEIVTQMPPVALLEGLAPDGLRAETVAVSLDGEAARLTWTINGALYVR"
     atggcgcgcc gtaaatcgat cgatacatct attgccgatc ggcagaagat cggcacgttc        60
     gtcctgaatg gaagaacgtt cgtaagcggt ctgcattggg aaaccctcga caacgtgtcc       120
     tcttttatga aagaggcgcg tagcaagggt cgccagtggg gcatggatgt cgtcgcaacc       180
     cgtaagggcg tcgacttgcg ctctaagggg aaaagcgcaa agtatcaggc tggctatgcg       240
     cccaagaacc gcggcgccgc caagggcatg tactccctgg cctcagtact tgcgagcgaa       300
     ttcggcagca actggatcgg tgcgtttcgc atcgaagagg aacgctatgc gctggcagcc       360
     gtcgtggatg gcagcattgt tccgagtgct gaccgaatcg gtacgctgtc agaaatccgc       420
     gaggagctag gcgccaactt tagtcactta gctggttcag gcgtgctctt tgagcatgtg       480
     attgcccccc cagagtttga atttggtgac aagcaggttg atctagcatc gctgttggtc       540
     gcctcgaagt tgaagccaga gcacaggcta aagccactta cgctggggtt gagcaagggt       600
     gagctgtttc ggctaaccct cttcgcggcg atcattgtcg ctggcggcgc gctgtacatc       660
     ctttaccagg caagggaaga agagatgctg cgtcgcgctg atcaggcgca gaaggcagca       720
     cgcgcccgcg cagaagctct gctaaacatc aagccgccgc caccggcgcc acctccacct       780
     tggcttgcct ctgcaaaaat cactgacacg gttgctgcat gttcggctgc tatcgacaag       840
     ctgccgctgg tattgggcgg ctggatcttc gagaaagcct cgtgcaatgc cggcggagcg       900
     ctctccgcgg cctataagag gggacacttg gctacggcca atagtgttct ttctgcggcc       960
     gaggcagcgg gactgccgct cgatttctac gacgccggtg agtctggtgt cgtcaatgtg      1020
     cttatccata tgccgtcggc cagtagcgaa gagctattgg cggaaaagca ggtgatggcc      1080
     cgacttgtct cacatttcca ggccgcaggc gtcaagttcc cgctgcagaa acaggcgatc      1140
     cccgaaacgc cgccagggga agagccgact acgagcaaac cgaactggtc gacgtacacc      1200
     ttcgagatcg tgacgcaaat gccgccagtg gcgctgttgg aagggctggc acctgatggg      1260
     ctgcgggcgg aaacagtcgc agtcagtcta gacggggagg ccgctaggct gacttggacc      1320
     attaacggag cactttatgt acggtaa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page