(data stored in ACNUC9435 zone)

EMBL: AM039951.PILQ

AM039951.PILQ        Location/Qualifiers
FT   CDS_pept        15739..17349
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="XCVd0014"
FT                   /product="putative PilQ-like type II/IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19826"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C090"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19826.1"
FT                   /translation="MVASVTSIAPESALPVAEPTKAVRYCRVLTAELGVYFVAESKRAV
FT                   VCLLADADGRSAELVVSSSHKTDPIVLSIFNILRRNAQNITWVTRYTQVSEIAKLYQLH
FT                   STNLVANDDDSARQDQVKGYIREANNMGASDLKIIVVGPYCRIRYTIHGRTKTYHELPA
FT                   AEGMLLSRALYNTMCAEMTGSGLDPNAMQDAQLKADVASQCGLVGSRISTRPANGRGIR
FT                   IVLRLLPPNRSAVQELEDLGYLPDSQIPILREVMALPFGIGLISGVTGSGKSTTLKAII
FT                   ENILRDSDQETDVLTIEDPVEYDIEAEGCTQTPLVYEQDDPEGRRNAWPNALRNAMRQA
FT                   PKIIVPGEIRDSESALIGYEAAVTGHFIWSTVHTFDAPSIIDRFRLLGVADDRLFNPAL
FT                   SVCLVNQSLLPQLCVSCRVPYLVGCAAIPAHVRTSIEEFCEVSKVYLQGPGCEECSGQT
FT                   PGVRGRKVAAEIIRPTAAFMEVFRRQGMVAARTYWVKQMGGITKLAHALTYVHSGLADP
FT                   RHVIRDVAALNTDRLHIGD"
     atggtcgcga gcgtaacctc gattgcgcct gagtcggcat tgccagttgc tgaacccaca        60
     aaggcagttc ggtactgtcg cgtgctcacc gcagaactgg gcgtctactt cgttgcggaa       120
     agcaaacgcg ccgttgtgtg cctacttgct gatgcagatg gtcgtagcgc cgagcttgtg       180
     gtgtcgagct cgcacaagac tgatccgatt gtgttgtcga tcttcaatat tctgcggcgg       240
     aacgcgcaaa acattacttg ggtgacacgc tacacgcagg tatcagaaat tgcgaagctt       300
     tatcagctgc actccacgaa cctcgtcgct aacgacgatg attcagccag gcaggaccaa       360
     gtcaaaggat acatccgaga ggccaataac atgggcgctt cggacttgaa aatcatcgtt       420
     gtaggaccgt attgccgaat caggtacacg attcacggta ggacaaagac ttaccatgag       480
     ctaccggctg ctgaaggtat gttgctctcg cgtgcactgt acaacacgat gtgcgcggag       540
     atgacaggct ccggtctcga tcccaacgcg atgcaggacg cgcagttgaa ggctgatgtg       600
     gccagccaat gtggcttagt cggctcgcgt atttcgacac gtccagccaa cggtcgaggt       660
     atccgaatcg ttttgcgctt gctgccgcca aatcggtctg cagtccagga gctcgaagat       720
     ctcggttacc tccctgacag ccaaatcccc atcctacggg aagtgatggc cttacccttc       780
     ggcatcgggc tgatttccgg agttacaggc tccgggaaat ccaccacgct taaggcaatc       840
     attgagaaca tcttgcgtga tagcgaccag gagacggacg tacttacgat tgaagatcct       900
     gttgagtacg acattgaggc agagggctgc acccaaacac cgctcgtcta tgagcaggac       960
     gaccccgagg ggcggcgcaa tgcgtggccc aatgcgctgc gtaacgcaat gcgccaagcg      1020
     ccaaaaatca tcgtgcccgg ggaaattcgt gattcggagt ccgctctgat cggctatgaa      1080
     gcggccgtga caggtcactt catttggtcc acggtgcaca cattcgatgc tccgagcatc      1140
     atcgatcgtt tccggctcct gggtgtggca gatgatcgtc tgttcaatcc cgcactttca      1200
     gtttgccttg tcaaccaatc cctgctgccg caactctgcg tttcctgcag ggttccttac      1260
     ctcgttgggt gcgccgcaat tccggcacat gtacgcacga gcattgaaga gttttgcgaa      1320
     gtcagcaagg tctacttgca gggaccaggc tgcgaggaat gcagcggcca aacaccaggc      1380
     gtgcgcggtc gtaaggtggc tgctgaaatc atcagaccga ctgcagcgtt catggaggtc      1440
     ttcaggcgac agggaatggt tgctgcccga acttattggg tcaaacagat gggtggcata      1500
     actaaactcg ctcacgcgct gacctacgtg cattccggcc tggcagatcc acgccatgtg      1560
     atcagagacg tggccgcgct taacactgat cgcttacata tcggagattg a               1611
//

If you have problems or comments...

PBIL Back to PBIL home page