(data stored in ACNUC9435 zone)

EMBL: AM039951.PILR

AM039951.PILR        Location/Qualifiers
FT   CDS_pept        17351..18448
FT                   /transl_table=11
FT                   /gene="pilR"
FT                   /locus_tag="XCVd0015"
FT                   /product="putative PilR-like integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19827"
FT                   /db_xref="GOA:Q3C089"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C089"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19827.1"
FT                   /translation="MAFADVWDSLSFDGIKSWAFKCYVKLGFGITARINFYESLTLSLD
FT                   NGESVLDTLEQQRAAFDEDGIAVLPAPQLVIINDCIRALTRGDQLADALEEWVGIQEVS
FT                   LVAAGESSGDLVAGLDRVVESLERRQELQRVLKEALMWPAFIGLGIVSAIFYISLELIP
FT                   ELLRMQPKEAWPAPTQKMISIGLFVVGNWFYMLAAFLIAASWLAWALPNLTGRIRDKFD
FT                   KLPFFSTYRVFVGTTFLLNVSALLAAGIPLEQALIDMARYANAYLRERIDDTLRGIKTG
FT                   ANFGQALHFTEHDFPDKDTVRNVKTLAEKKGFEVALEKFTKRWLKQNMKLMERSAAILR
FT                   LIMLLIGAYVIVTMFQGVYGIAQRR"
     atggcattcg ccgatgtatg ggattcgctc tcgtttgacg ggataaagag ctgggcattc        60
     aagtgctatg tgaagctcgg ctttggcatt acagcgcgga tcaacttcta cgagtctttg       120
     accctttctc tcgacaacgg tgagagcgtt ctggacacgc ttgagcagca acgagctgcc       180
     tttgatgaag acggaattgc ggtattgcct gcgccacagc tggtgatcat caatgactgt       240
     attcgtgccc tgacacgtgg tgaccaattg gctgacgcgc tcgaagagtg ggttggcatt       300
     caagaggtct cactggtcgc ggccggtgag tcgtcaggtg acttagtagc aggtttggac       360
     cgcgttgtgg aatcactgga gcgcaggcaa gagcttcaac gtgtgctgaa agaagctctg       420
     atgtggccgg cattcatcgg cctcgggatt gtatctgcga ttttttacat ctcgctggag       480
     ctgattcccg agctactgcg gatgcagcca aaggaggcgt ggccggcacc cactcagaag       540
     atgataagca taggtctctt cgtcgtcgga aattggtttt acatgctcgc tgcatttctg       600
     attgctgcta gttggctggc ttgggccctc cccaatctca ctggccgcat acgagacaaa       660
     ttcgacaagc tgccgttttt ctcgacgtat cgtgtgtttg tcggaacaac atttctgctc       720
     aatgtgtcgg cgttgctggc ggccgggatt ccacttgagc aggcactgat tgacatggcg       780
     aggtacgcaa atgcatatct gcgcgaacgc atagacgaca cgttgcgtgg catcaaaacg       840
     ggtgccaact tcggtcaagc actgcacttc actgagcatg actttcctga caaggacacc       900
     gtcagaaacg tcaaaacatt agctgaaaaa aagggctttg aggttgcgct agagaaattc       960
     actaaacgct ggctcaagca aaatatgaag ctgatggaac gatcagccgc cattttgcgc      1020
     ctgatcatgc tgctgatcgg agcgtatgta atcgtaacga tgttccaagg cgtttacggt      1080
     atcgcgcagc gacgttaa                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page