(data stored in ACNUC9435 zone)

EMBL: AM039951.PILT

AM039951.PILT        Location/Qualifiers
FT   CDS_pept        18707..20026
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="XCVd0016"
FT                   /product="putative PilT-like type II/IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19828"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C088"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19828.1"
FT                   /translation="MERVAPICCLLRSTASVSRPLCRLLVRRFQISSAAQLPWFLLVPV
FT                   SSSAQQRFLRKSAVALSQTYPSLGHTARRSMAGLGSPGRCRLPKQMLVAVRMPTRSLGR
FT                   SPTKPRVSSMQLKDLPVVDIYLGHDYSLMKDLPGAQAPGSAAPDQLKQELANVRGLCLE
FT                   MFEKSGDPEFALSLDGFVYRVTTFVDTSTHPVFVLSRAASKVIPIERLDIPKHAKEAVL
FT                   SPRTRGIVLVTGEMGSGKTVTATTLFVERLRQTRSIGLALEDPIESNLNGPHGDGWCIH
FT                   VQVSRREGGYREYLIRSMRSRAETIYLGELRDESSAEQAVQLSNMGHLVFTTVHGGDLP
FT                   QAIERILSLSRGLRDPSGMLAEGLAVIIHQKLVHSTALPGGTSIPRLVAKALTLVPAHG
FT                   DERGEAFSKSARALIRTNELSKLQTLIEQQSNAATWRGNP"
     atggagcgag tggcaccaat ctgctgcctg ctgcgatcaa ccgccagtgt atcccgacca        60
     ctatgccggt tactggtacg acggtttcaa atcagttcgg cggcgcagtt accttggttt       120
     ctactggtac cggtttcatc ttcagcacag cagcgattcc tacggaagtc tgcggtggca       180
     ttgtcacaga cctatcccag tctggggcat acagcacgaa gatcaatggc gggactggga       240
     tcaccgggcc ggtgtcggtt gcccaagcag atgctggttg cagttcggat gccaactcga       300
     tcgcttggac gatctccaac taagccgcga gtcagttcaa tgcagctcaa agacctgcct       360
     gttgtcgaca tctatctggg acacgactat agcctcatga aggatctgcc gggcgcgcaa       420
     gcgcccggca gtgccgcgcc cgatcagctc aagcaagagc tggcgaacgt aagaggccta       480
     tgcctagaaa tgttcgagaa gtccggcgat cctgaatttg ctttgagctt ggatggcttt       540
     gtgtaccgtg tgacaacatt cgttgatacc agcacacacc cagtgtttgt tctttcacgc       600
     gcggcgagca aggttattcc aattgaacga ttggatattc ctaagcatgc gaaggaggct       660
     gtgctttccc ctaggacacg gggcatcgtt ctagtgacag gagaaatggg atctggaaag       720
     acagtgaccg cgacaacgct tttcgtcgag cgtctgcgac agactagatc aatcggcctt       780
     gcccttgaag atcccattga gtctaacctc aacggcccgc acggggacgg ctggtgtatc       840
     catgtccaag tctcgcgacg agagggggga taccgcgagt atctgattcg atcgatgcgt       900
     tcacgcgcag aaacaatcta tctcggtgaa ctccgcgatg aatcatcggc agagcaggca       960
     gtgcagctca gtaacatggg gcatctggtg tttacaaccg tgcatggtgg tgatttgccg      1020
     caggcaatag agcgcattct gtctctctct agaggcttgc gcgatccatc tggcatgttg      1080
     gccgagggtt tggcagtgat cattcaccaa aagctagtgc attccacggc tctgcctggc      1140
     ggcacctcaa tacctcgcct ggttgccaag gcgttaacgc ttgtgccggc acatggggac      1200
     gagcgcggcg aggctttttc gaaatcggcc agagctctga ttcgcaccaa tgagctctca      1260
     aaattacaaa cgttaattga gcagcaatcc aacgccgcaa catggagggg caacccatga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page