(data stored in ACNUC9435 zone)

EMBL: AM039951.RDGC

AM039951.RDGC        Location/Qualifiers
FT   CDS_pept        142680..143591
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="XCVd0134"
FT                   /product="recombination associated protein / putative
FT                   exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19946"
FT                   /db_xref="GOA:Q3BZX0"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19946.1"
FT                   /translation="MAFFRNLTLFRFPTATDFSEVDQLLPAVVLKPVGPLEMNSRGFMS
FT                   PFGREQQVTLSHRLGDFLWLTVGGEDKILPAAVVNDALARKISEIEAKEGRKPGGRERK
FT                   RIKDDLIHELLPRAFVKSSRTDAVLDLRNGYIAVDTSSRKTAESVMSQIRGLLGSFPAM
FT                   PLNAEVAPRGVLTGWIAGEPLPEGLSLGEECEMKDPVEGGATVRCSAQELRSDEIDRHL
FT                   DAGKQVTKLAMVLDDHLSFVAGDDLVIRKLKFLDGALDQLEEADQEGLRAEFDARFALM
FT                   SGELRRLFSLLETAFKLSAAEA"
     atggcattct tccgcaatct cacgctcttc cgctttccta ccgcgaccga tttcagcgaa        60
     gtcgaccagc tcctaccggc cgtggtcctc aagccggtcg gaccactgga gatgaattcg       120
     cgcgggttca tgtctccctt cggtcgcgag caacaggtaa ctctgtccca taggttgggt       180
     gatttcctgt ggctcaccgt tgggggcgaa gacaagatcc tgccggctgc cgtcgtgaac       240
     gatgcgctgg cccgcaagat ctcagaaatc gaagcgaaag aaggccgcaa gccgggtggg       300
     cgtgagcgca agcgcatcaa agacgacctg atccacgaac tgctgccgcg tgcctttgtg       360
     aaatcgtctc gtaccgatgc ggtcctggac ctgcgcaatg ggtatatcgc cgttgacacc       420
     tccagtcgca agactgcaga aagcgtgatg tcccagatcc gtggcttgct gggttcgttc       480
     ccagcgatgc cgctgaacgc ggaagtggcg ccgcgcggcg tgctgaccgg atggatcgcc       540
     ggcgaaccgc tccctgaggg actgagcctg ggcgaggaat gcgagatgaa ggatccggtc       600
     gagggtggcg cgacggtccg ctgcagcgcg caggagctgc gcagcgacga gatcgaccgg       660
     cacctggacg ccggcaagca ggtaaccaaa ctcgccatgg tgctggacga ccatctttcg       720
     ttcgtggctg gcgacgacct ggtcatccgc aagctgaagt ttctggatgg cgccctcgac       780
     cagctggaag aggcagacca ggaaggcctg agagcggagt tcgacgcccg ctttgccctg       840
     atgagcggtg agctccgccg gctgttctcg ttgctcgaaa ccgccttcaa gctcagcgcg       900
     gcggaggcat ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page