(data stored in ACNUC9435 zone)

EMBL: AM039951.REPA

AM039951.REPA        Location/Qualifiers
FT   CDS_pept        456..1748
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="XCVd0001"
FT                   /product="Replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19813"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19813.1"
FT                   /translation="MSTTAEQSPTPSIGADYLVQLGDRIGQMVMRAKDFSHPSKLSPEQ
FT                   GESRRLSLREIADSIGVSHSTVNRVAANMMGPDAAGGTESPKSTGRTGYRYSLAEAVAL
FT                   RKAIAELPEIRKKAKLDRRRGAGEPCVTLGIMNFKGGVAKSTTTAHAGAYLSLHGYRTL
FT                   VIDTDPQATLSTLFGIHPDIELSVEDTLLPYFEGSETSLDYCIRKTEIPTLDVIPSNVG
FT                   LASADLVLPSRQRDMRQAGDLSWFYMKVLAEGIATIEKDYDVILIDCPPSMSYLTTVAT
FT                   QACDALLVPMRPSMPDFASSAQFIRMFGGFQREVDEVVGNAKEFDWIQVLITLGENNNA
FT                   SAEMEAIIRKAYGDLVMGEKFPYLTAVARAAKAMRTIYDVARADTDTRQLSKAMNIVNQ
FT                   LCQSIEARLLLTRARLTAQSNGNQGETEEAV"
     atgagcacga ccgcggagca gtcccccacc ccgtccattg gcgccgatta ccttgtgcag        60
     cttggcgatc gcattggcca gatggtcatg cgtgccaagg acttttccca cccaagcaag       120
     ctgagtccgg aacagggcga gagccgccgg ctgagcttgc gggagattgc cgactcgatt       180
     ggcgtcagcc attcgacggt caaccgggtg gccgcgaaca tgatgggtcc ggatgctgct       240
     ggcggcactg aaagtccgaa gtccacgggg cgcaccggtt acaggtatag cctggctgaa       300
     gcggtggcgt tgcgaaaagc gatcgcggag ctgccggaaa tccggaagaa ggccaagctg       360
     gaccggcgcc gtggcgccgg cgagccctgc gtgacgttgg gaatcatgaa cttcaagggg       420
     ggcgtcgcga aatcgaccac cacggctcac gccggcgctt acctgagcct acacggctac       480
     cgaaccctgg tgatcgacac cgacccgcag gcaacgctgt cgaccctctt cgggattcat       540
     cccgatatcg aattgtctgt cgaagacacg ctgctccctt atttcgaggg ttccgagacg       600
     tcgcttgatt actgcatccg caagacggag atccccacgt tagacgtgat cccgtcgaac       660
     gtggggttgg cgtcggcgga tctggtgctg ccgtcgcgtc agcgagatat gcgtcaggct       720
     ggcgatctgt cgtggttcta catgaaagtc ttggcggaag gtatcgcaac catcgagaag       780
     gattacgacg tgatcctgat tgactgccca ccttccatgt cctacctgac cacagtggcc       840
     acccaggcct gtgatgcgtt gctggtaccc atgcgtcctt cgatgccgga ttttgcatcc       900
     tccgctcagt tcatccggat gttcggcggc ttccaacgag aggtggacga ggttgtcggc       960
     aacgcgaaag aattcgactg gatccaggtt ctcattacgc tgggagagaa caacaatgcc      1020
     tcggcggaaa tggaagccat catccgcaag gcgtatgggg atctggttat gggtgagaag      1080
     tttccctatc tgacggcagt cgcccgggcg gcgaaagcaa tgcgcacgat ctacgacgta      1140
     gcccgtgcgg acactgacac ccgccagctg agcaaggcca tgaacatcgt caatcagctg      1200
     tgccagtcca ttgaggcccg cctcctgctc acgcgtgcga ggttgactgc acagagcaat      1260
     ggcaatcaag gcgagactga ggaggcggta tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page