(data stored in ACNUC9435 zone)

EMBL: AM039951.REPB

AM039951.REPB        Location/Qualifiers
FT   CDS_pept        1745..2743
FT                   /transl_table=11
FT                   /gene="repB"
FT                   /locus_tag="XCVd0002"
FT                   /product="Replication protein B"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19814"
FT                   /db_xref="GOA:Q3C0A2"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19814.1"
FT                   /translation="MSKQKARSAALLGAMDGEGFPPLAHGAGSGSARPDSSVPALGMVS
FT                   ELARDELRLARERVAQLQGQLDAVAAAGSVQLVDPAKITHTQYRDRDELGFRDEKYEEL
FT                   KEDIRRKGRNEQPILLRPARAENVAAGFEFEVVWGHRRHRVTSELGIPVEAIVRDVTDR
FT                   EAVLLMSSENARREGLSQYEQARKYRTWLKAGLFENMVAIAEAEGVHKATISRIMSIND
FT                   LPDEVFVALKDPRKVTGLFAAKFLQAAETNEEAVESLKDLEKKLTPGELLKKVAPVGPK
FT                   MDPIEFKAGERRIFEAVPVAAEGGTKFSELRLHIELDQDKLRRLAEFAASL"
     atgagcaagc agaaggcaag aagcgcggcg ctgctggggg caatggacgg cgagggcttc        60
     ccgccgctcg cccatggtgc tggttccggt tccgcccggc cggacagctc ggttccggcc       120
     ttgggaatgg tgagcgagct ggcccgcgat gagttgcgcc tggcgcgcga gagggtggct       180
     caactgcagg ggcaactcga cgccgtggca gcagcggggt cggttcagct ggtagacccc       240
     gcaaagatca cccacacgca gtatcgcgat cgggacgagc tcggattccg cgacgagaag       300
     tatgaggagc tgaaggaaga catccggcgg aagggacgga acgagcagcc cattctccta       360
     cgtcccgctc gcgccgagaa tgtcgctgcc ggcttcgagt tcgaggtcgt ctgggggcat       420
     cggcgtcatc gcgtgacatc ggaactgggc atcccggtgg aagcgatcgt gcgggatgta       480
     actgatcgcg aagcggtgct gttgatgtcc agtgagaatg cgcgccggga gggcttgagc       540
     cagtacgagc aggctcgaaa gtaccggacc tggcttaagg ctggtctgtt cgagaatatg       600
     gttgcaatcg ccgaagcaga aggcgtccac aaggcaacaa tcagtcggat catgtcgatc       660
     aacgacctcc ctgatgaagt ctttgttgcc ttgaaggatc cgcgaaaggt caccggccta       720
     tttgccgcga agttcctcca ggcggctgag acaaatgagg aagccgttga atctctcaaa       780
     gacttggaga agaaactgac tccgggtgag cttcttaaga aagttgcgcc ggtcggcccc       840
     aagatggatc cgatagagtt caaagcgggg gagcggcgga tcttcgaggc ggttcctgtc       900
     gccgctgaag gcggcaccaa gttcagcgaa ctgcgacttc atatcgaact tgaccaagac       960
     aagttgagga ggttggcaga gttcgccgct agcttgtaa                              999
//

If you have problems or comments...

PBIL Back to PBIL home page