(data stored in ACNUC9435 zone)

EMBL: AM180355.CBIN

AM180355.CBIN        Location/Qualifiers
FT   CDS_pept        392127..392411
FT                   /transl_table=11
FT                   /gene="cbiN"
FT                   /locus_tag="CD630_03250"
FT                   /old_locus_tag="CD0325"
FT                   /product="ABC-type transport system, cobalt-specific
FT                   extracellular solute-binding protein"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: down-regulated in Spo0A
FT                   mutant PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67147"
FT                   /db_xref="GOA:Q18D62"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D62"
FT                   /protein_id="CAJ67147.1"
FT                   /translation="MSAKTKTKTNILLLLLVVALIIFPLLVNSGAEYGGADGQAESEIT
FT                   KINPNYKPWFSSPYEPPSGEIESLLFSAQAALGAGVIGYILGLQKGKRS"
     atgagtgcta aaacaaaaac aaaaactaac atattattac ttttattagt agtagctctt        60
     attatattcc cattacttgt caactcaggt gctgaatatg gaggagcaga tggtcaagct       120
     gaaagtgaaa ttactaagat aaatccaaat tacaaaccat ggtttagcag tccatatgag       180
     ccaccaagtg gagaaataga aagtttatta ttctctgcac aagcagcttt aggggctggt       240
     gtaataggat acatattagg tcttcaaaaa ggaaagagaa gttaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page