(data stored in ACNUC9435 zone)

EMBL: AM180355.CBIO1

AM180355.CBIO1       Location/Qualifiers
FT   CDS_pept        118441..119274
FT                   /transl_table=11
FT                   /gene="cbiO1"
FT                   /locus_tag="CD630_01000"
FT                   /old_locus_tag="CD0100"
FT                   /product="ABC-type transport system, cobalt-specific
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66919"
FT                   /db_xref="GOA:Q18CJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CJ0"
FT                   /protein_id="CAJ66919.1"
FT                   /translation="MDNIVKVNNISFEYITDEAKLKAIDNLSLDVKKGEFVAIIGHNGS
FT                   GKSTLSKNLNAILMPTEGNILIDDMDTKEEERLWDIRQTAGMVFQNPDNQIVATIVEED
FT                   VAFGPENLGIEPKEIRRIVEESLKSVGMYDLRDRQPHLLSGGQKQRVAIAGIIAMRPKC
FT                   IIFDEATAMLDPSGRKEVMKTIKRLNKEENITVIHITHFMEEAVEADRVVVMEKGKKIL
FT                   EGTPREVFSKIKMLKEIGLDVPCMTELSSLLIEEGINISSDILTVDEMVMELCQL"
     atggataata tagtaaaggt aaataatatt tcgtttgagt atattacaga tgaagcaaaa        60
     cttaaagcaa tagataattt aagcctagat gttaaaaaag gagaatttgt tgcgataata       120
     ggacataatg gttctggtaa gtctacttta tctaaaaact taaatgctat tcttatgcct       180
     actgaaggaa atattcttat tgatgatatg gatactaaag aagaagaaag attatgggat       240
     ataagacaaa ctgcaggcat ggtatttcaa aatccagata atcaaatagt tgctactata       300
     gtagaagaag acgttgcatt tggacctgag aacttaggta tagaaccaaa agaaataaga       360
     cgaattgtag aggagtcttt aaaaagtgta ggtatgtatg atttaagaga tagacagcct       420
     catttgttat caggaggtca aaagcaaaga gttgcaatag caggaattat tgctatgagg       480
     cctaaatgta taatatttga tgaagcaaca gcaatgttag atccatctgg aagaaaagaa       540
     gttatgaaaa caataaaaag acttaataag gaagaaaata taactgttat acatataacg       600
     cactttatgg aagaagcagt agaagctgat agagttgtag ttatggaaaa aggaaagaaa       660
     atcttagagg gaactcctag agaagtattc agtaaaataa agatgttaaa ggaaatcggt       720
     ttagatgtac cttgtatgac agagttatct agtttattaa tagaagaagg tataaatatt       780
     agtagtgata tattaactgt ggatgagatg gtgatggaat tatgtcaatt atag             834
//

If you have problems or comments...

PBIL Back to PBIL home page